UniProt UniProt http://www.uniprot.org hauge-2009-3 Evidence for the involvement of FAM110C protein in cell spreading and migration. human-hep_g2 Homo sapiens hepatocellular carcinoma (HCC) cells (p53-wt). hep_g2 human hepatocellular carcinoma (HCC) cells (p53-wt). anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Hauge H., Fjelland K.E., Sioud M., Aasheim H.C. Cells have been stimulated with HGF Origin of HA-tagged Akt1 according pmid 7774014 (Ref 35) and pmid 8437858 cited therein. In exp. demonstrating CoIP of alpha-tubulin, the protein is omitted as antibody is not specific. h.c.asheim@labmed.uio.no Cell. Signal. (0898-6568) 2009 Only protein-protein interactions imex curation hauge-2009-1 Evidence for the involvement of FAM110C protein in cell spreading and migration. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Hauge H., Fjelland K.E., Sioud M., Aasheim H.C. Origin of HA-tagged Akt1 according pmid 7774014 (Ref 35) and pmid 8437858 cited therein. In exp. demonstrating CoIP of alpha-tubulin, the protein is omitted as antibody is not specific. h.c.asheim@labmed.uio.no Cell. Signal. (0898-6568) 2009 Only protein-protein interactions imex curation hauge-2009-2 Evidence for the involvement of FAM110C protein in cell spreading and migration. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Hauge H., Fjelland K.E., Sioud M., Aasheim H.C. Origin of HA-tagged Akt1 according pmid 7774014 (Ref 35) and pmid 8437858 cited therein. In exp. demonstrating CoIP of alpha-tubulin, the protein is omitted as antibody is not specific. h.c.asheim@labmed.uio.no Cell. Signal. (0898-6568) 2009 Only protein-protein interactions imex curation hauge-2009-4 Evidence for the involvement of FAM110C protein in cell spreading and migration. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. confocal microscopy confocal microscopy immunostaining immunostaining Hauge H., Fjelland K.E., Sioud M., Aasheim H.C. Origin of HA-tagged Akt1 according pmid 7774014 (Ref 35) and pmid 8437858 cited therein. In exp. demonstrating CoIP of alpha-tubulin, the protein is omitted as antibody is not specific. h.c.asheim@labmed.uio.no Cell. Signal. (0898-6568) 2009 Only protein-protein interactions imex curation f110c_human Protein FAM110C FAM110C protein protein human Homo sapiens Human MRALAALSAPPNERLLPRDPAATRDPDAARPARRSAVERLAADRAKYVRGRPGTGRGVASEGSGPGAIKCPGNDPGPPARAPAPVARRAIARKPLRPDSLIIYRQKCEFVRGSGADGPRASLVKKLFQGPGKDKAPVPRTGDEGKAGNPETVPTTPGPAADPAIPETPAPAARSAAPSSVPAAPPGPEPRVVRRRGLQRSQSDLSSRYSAALAESDTFFQYCGLDPEVVEALGRENFTAGSDCVTLKVRSVSVATSGSGFSRHSGGDDEGLQEEELIEQVPSTTSVIERNARIIKWLYTCKKAKETPSQEQSRTRGSKPSR akt1_human RAC-alpha serine/threonine-protein kinase AKT1 PKB RAC RAC-PK-alpha Protein kinase B Proto-oncogene c-Akt Protein kinase B alpha protein protein human Homo sapiens Human MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA akt1_mouse RAC-alpha serine/threonine-protein kinase Akt1 Akt Rac RAC-PK-alpha AKT1 kinase Proto-oncogene c-Akt Protein kinase B Thymoma viral proto-oncogene Protein kinase B alpha protein protein mouse Mus musculus Mouse MNDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQRESPLNNFSVAQCQLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWATAIQTVADGLKRQEEETMDFRSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKSLLSGLLKKDPTQRLGGGSEDAKEIMQHRFFANIVWQDVYEKKLSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA akt1-fam110c-2 1385524 n/a 1385528 unspecified role unspecified role prey prey n/a 1385529 unspecified role unspecified role bait bait possible_phos_res phosres phosphorylated residue PhosRes Phospho Phosphorylation Phosphorylation (O of Serine, Threonine, Tyrosine and Aspartate, N epsilon of Lysine) undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4B fam110c-akt1-2 1385524 n/a 1385529 unspecified role unspecified role prey prey n/a 1385528 unspecified role unspecified role bait bait physical association physical association false false false 4B Alpha-tubulin was also precipitated. akt1-fam110c-1 1385525 n/a 1385528 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1385530 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4A fam110c-akt1 1385526 n/a 1385530 unspecified role unspecified role prey prey nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1385528 unspecified role unspecified role bait bait nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false 4A alpha-tubulin was also precipitated akt1-fam110c-4 1385527 n/a 1385530 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1385528 unspecified role unspecified role neutral component neutral component nucl transfection nucleic acid transfection nucl transfection region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 5