UniProt UniProt http://www.uniprot.org liu-2009a-1 Molecular and reverse genetic characterization of NUCLEOSOME ASSEMBLY PROTEIN1 (NAP1) genes unravels their function in transcription and nucleotide excision repair in Arabidopsis thaliana. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Liu Z., Zhu Y., Gao J., Yu F., Dong A., Shen W.H. wen-hui.shen@ibmp-ulp.u-strasbg.fr Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation liu-2009-2 Molecular and reverse genetic characterization of NUCLEOSOME ASSEMBLY PROTEIN1 (NAP1) genes unravels their function in transcription and nucleotide excision repair in Arabidopsis thaliana. in vitro In vitro pull down pull down anti tag western anti tag western blot anti tag western Liu Z., Zhu Y., Gao J., Yu F., Dong A., Shen W.H. Interactions containing Histone H2A cannot be annotated as the identity of the Histone involved cannot be found. wen-hui.shen@ibmp-ulp.u-strasbg.fr Plant J. (0960-7412) 2009 Only protein-protein interactions imex curation nap1a_arath Nucleosome assembly protein 1;1 NAP1;1 NFA1 Nucleosome/chromatin assembly factor group A1 F20B18.220 At4g26110 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNDKDSFNVSDLTAALKDEDRAGLVNALKNKLQNLAGQRSDVLENLTPNVRKRVDALRDIQSQHDELEAKFREERAILEAKYQTLYQPLYVKRYEIVNGTTEVELAPEDDTKVDQGEEKTAEEKGVPSFWLTALKNNDVISEEVTERDEGALKYLKDIKWCKIEEPKGFKLEFFFDTNPYFKNTVLTKSYHMIDEDEPLLEKAMGTEIDWYPGKCLTQKILKKKPKKGSKNTKPITKLEDCESFFNFFSPPEVPDEDEDIDEERAEDLQNLMEQDYDIGSTIREKIIPRAVSWFTGEAMEAEDFEIDDDEEDDIDEDEDEEDEEDEEDDDDEDEEESKTKKKPSIGNKKGGRSQIVGEGKQDERPPECKQQ nap1b_arath Nucleosome assembly protein 1;2 NAP1;2 NFA2 Nucleosome/chromatin assembly factor group A2 F3P11.8 At2g19480 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNDKDSMNMSDLSTALNEEDRAGLVNALKNKLQNLAGQHSDVLENLTPPVRKRVEFLREIQNQYDEMEAKFFEERAALEAKYQKLYQPLYTKRYEIVNGVVEVEGAAEEVKSEQGEDKSAEEKGVPDFWLIALKNNEITAEEITERDEGALKYLKDIKWSRVEEPKGFKLEFFFDQNPYFKNTVLTKTYHMIDEDEPILEKALGTEIEWYPGKCLTQKILKKKPKKGSKNTKPITKTEDCESFFNFFSPPQVPDDDEDLDDDMADELQGQMEHDYDIGSTIKEKIISHAVSWFTGEAVEADDLDIEDDDDEIDEDDDEEDEEDDEDDEEEDDEDDDEEEEADQGKKSKKKSSAGHKKAGRSQLAEGQAGERPPECKQQ nap1c_arath Nucleosome assembly protein 1;3 NAP1;3 NFA3 Nucleosome/chromatin assembly factor group A3 MHM17.6 At5g56950 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNDKDSFNVSDLTSALKDEDRAGLVNALKNKLQNLAGQHSDVLENLTPKIRRRVEVLREIQGKHDEIETKFREERAALEAKYQKLYQPLYNKRYEIVNGATEVEGAPEDAKMDQGDEKTAEEKGVPSFWLTALKNNDVISEEITERDEGALIYLKDIKWCKIEEPKGFKLEFFFDQNPYFKNTLLTKAYHMIDEDEPLLEKAIGTEIDWYPGKCLTQKILKKKPKKGAKNAKPITKTEDCESFFNFFNPPQVPDDDEDIDEERAEELQNLMEQDYDIGSTIREKIIPHAVSWFTGEAIEGEEFEIDNDDEDDIDEDEDEDEEDEDEDEEEDDEDEEEEVSKTKKKPSVLHKKGGRPQVTDDQQGERPPECKQQ nap1d_arath Nucleosome assembly protein 1;4 NAP1;4 NFA4 Nucleosome/chromatin assembly factor group A4 MMM17.22 At3g13782 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MSNEENIKSDNKSGDSSDLPTIPALDIGAEECDLLAELKNLTLKRPFDVKKLSPKVTKRVLFLKDIQVTHDELEEKFLAEKSALEATYDNLYKPLFAKRYEIVNGVVEAEAEKEGVPNFWLIAMKTNEMLANEITERDEAALKYLKDIRSCRVEDTSRNFKLEFLFDSNLYFKNSVLSKTYHVNDEDGPVLEKVIGTDIEWFPGKCLTHKVVVKKKTKKGPKKVNNIPMTKTENCESFFNFFKPPEIPEIDEVDDYDDFDTIMTEELQNLMDQDYDIAVTIRDKLIPHAVSWFTGEALVDEDDSDDNDDDDNDEKSD as1_arath Transcription factor AS1 Protein ASYMMETRIC LEAVES 1 Myb-related protein 91 Protein PHANTASTICA AS1 MYB91 PHAN At2g37630 F13M22.13 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MKERQRWSGEEDALLRAYVRQFGPREWHLVSERMNKPLNRDAKSCLERWKNYLKPGIKKGSLTEEEQRLVIRLQEKHGNKWKKIAAEVPGRTAKRLGKWWEVFKEKQQREEKESNKRVEPIDESKYDRILESFAEKLVKERSNVVPAAAAAATVVMANSNGGFLHSEQQVQPPNPVIPPWLATSNNGNNVVARPPSVTLTLSPSTVAAAAPQPPIPWLQQQQPERAENGPGGLVLGSMMPSCSGSSESVFLSELVECCRELEEGHRAWADHKKEAAWRLRRLELQLESEKTCRQREKMEEIEAKMKALREEQKNAMEKIEGEYREQLVGLRRDAEAKDQKLADQWTSRHIRLTKFLEQQMGCRLDRP as2_arath Protein ASYMMETRIC LEAVES 2 AS2 LBD6 LOB domain-containing protein 6 F5I14.15 At1g65620 protein protein arath Arabidopsis thaliana (Mouse-ear cress) Mouse-ear cress MASSSTNSPCAACKFLRRKCQPECVFAPYFPPDQPQKFANVHKVFGASNVTKLLNELHPSQREDAVNSLAYEADMRLRDPVYGCVGVISLLQHQLRQLQIDLSCAKSELSKYQSLGILAATHQSLGINLLAGAADGTATAVRDHYHHHQFFPREQMFGGLDVPAGNNYDGGILAIGQITQFQQPRAAAGDDGRRTVDPS nap1;1-nap1;1 1430177 n/a 1430179 unspecified role unspecified role prey prey n/a 1430179 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1a nap1;2-nap1;2 1430177 n/a 1430180 unspecified role unspecified role bait bait n/a 1430180 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1a nap1;3-nap1;3 1430177 n/a 1430181 unspecified role unspecified role bait bait n/a 1430181 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1a nap1;1-nap1;2 1430177 n/a 1430179 unspecified role unspecified role bait bait n/a 1430180 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1a nap1;1-nap1;3 1430177 n/a 1430181 unspecified role unspecified role prey prey n/a 1430179 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1a nap1;2-nap1;1 1430177 n/a 1430179 unspecified role unspecified role prey prey n/a 1430180 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1a nap1;2-nap1;3 1430177 n/a 1430180 unspecified role unspecified role bait bait n/a 1430181 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1a nap1;3-nap1;1 1430177 n/a 1430181 unspecified role unspecified role bait bait n/a 1430179 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1a nap1;3-nap1;2 1430177 n/a 1430180 unspecified role unspecified role prey prey n/a 1430181 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1a nap1;1-nap1;4 1430177 n/a 1430179 unspecified role unspecified role bait bait n/a 1430182 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1a nap1;2-nap1;4 1430177 n/a 1430182 unspecified role unspecified role prey prey n/a 1430180 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1a nap1;3-nap1;4 1430177 n/a 1430181 unspecified role unspecified role bait bait n/a 1430182 unspecified role unspecified role prey prey physical association physical association false false false Fig. 1a as2-as1 1430177 n/a 1430183 unspecified role unspecified role prey prey n/a 1430184 unspecified role unspecified role bait bait physical association physical association false false false Fig. 1a nap1;2-nap1;2-1 1430178 n/a 1430180 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath-seedling Arabidopsis thaliana seedling n/a 1430180 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1b nap1;2-nap1;3-1 1430178 n/a 1430181 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath-seedling Arabidopsis thaliana seedling n/a 1430180 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1b nap1;2-nap1;4 1430178 n/a 1430180 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1430182 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath-seedling Arabidopsis thaliana seedling physical association physical association false false false Fig. 1b map1;1-nap1;2 1430178 n/a 1430180 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath-seedling Arabidopsis thaliana seedling n/a 1430179 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1b nap1;1-nap1;3-1 1430178 n/a 1430181 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath-seedling Arabidopsis thaliana seedling n/a 1430179 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1b nap1;1-nap1;4 1430178 n/a 1430182 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath-seedling Arabidopsis thaliana seedling n/a 1430179 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1b nap1;3-nap1;2-1 1430178 n/a 1430181 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1430180 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath-seedling Arabidopsis thaliana seedling physical association physical association false false false Fig. 1b nap1;3-nap1;3-1 1430178 n/a 1430181 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath-seedling Arabidopsis thaliana seedling n/a 1430181 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1b nap1;3-nap1;4 1430178 n/a 1430181 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1430182 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath-seedling Arabidopsis thaliana seedling physical association physical association false false false Fig. 1b nap1;4-nap1;2-1 1430178 n/a 1430180 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath-seedling Arabidopsis thaliana seedling n/a 1430182 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1b nap1;4-nap1;3-1 1430178 n/a 1430181 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath-seedling Arabidopsis thaliana seedling n/a 1430182 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1b nap1;4-nap1;4 1430178 n/a 1430182 unspecified role unspecified role prey prey region yfp tag yellow fluorescent protein tag YFP yellow fluorescent protein yellow fluorescent protein YFP yfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arath-seedling Arabidopsis thaliana seedling n/a 1430182 unspecified role unspecified role bait bait n-term his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1b