HPIDb Host Pathogen Interaction database http://www.agbase.msstate.edu/hpi/main.html http://www.agbase.msstate.edu/hpi/main.html sheeba-2007-1 Chick Hairy1 protein interacts with Sap18, a component of the Sin3/HDAC transcriptional repressor complex. in vitro In vitro 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Sheeba C.J., Palmeirim I., Andrade R.P. rpandrade@ecsaude.uminho.pt Stage HH20 – HH22 chick embryo cDNA BMC Dev. Biol. 2007 imex curation Only protein-protein interactions imex curation sheeba-2007-2 Chick Hairy1 protein interacts with Sap18, a component of the Sin3/HDAC transcriptional repressor complex. in vitro In vitro anti tag coip anti tag coimmunoprecipitation anti tag coip weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Sheeba C.J., Palmeirim I., Andrade R.P. rpandrade@ecsaude.uminho.pt Stage HH20 – HH22 chick embryo cDNA BMC Dev. Biol. 2007 imex curation Only protein-protein interactions imex curation sheeba-2007-3 Chick Hairy1 protein interacts with Sap18, a component of the Sin3/HDAC transcriptional repressor complex. in vitro In vitro 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sheeba C.J., Palmeirim I., Andrade R.P. rpandrade@ecsaude.uminho.pt Stage HH20 – HH22 chick embryo cDNA BMC Dev. Biol. 2007 imex curation Only protein-protein interactions imex curation q6xlq0_chick hairy1 HES4 protein protein chick Gallus gallus (Chicken) Chicken MPADTGMEKPTASPIAGAPASASHTPDKPRSASEHRKSSKPIMEKRRRARINESLGQLKMLILDALKKDSSRHSKLEKADILEMTVKHLRNLQRAQMAAALSADPSVLGKYRAGFNECMNEVTRFLSTCEGVNADVRARLLGHLSACLGQIVAMNYLPPPPAGQPAHLAQPLHVQLPPTTTGAVPVPCKLEPTEALSPKVYGGFQLVPATDGQFAFLIPNPAFPPGSGPVIPLYANANVPVSTSGGSGNASTTPSASPVQGLTSFGHSVVPASQAGSPIAERRESVWRPW q90zh5_chick Histone deacetylase complex subunit SAP18 chSAP18 protein protein chick Gallus gallus (Chicken) Chicken MAVESRVTQEEIKKEPEKPIDREKTCPLLLRVFTTNNGRHHRMDEFSRGNVPSSELQIYTWMDATLKELTSLVKEVYPEARKKGTHFNFAIVFTDLKRPGYRVKEIGSTMSGRKGTDDSMTLQSQKFQIGDYLDIAITPPNRAPPPSSRMRPY hairy1-hairy1-1 1386062 n/a Hairy1 1386065 unspecified role unspecified role prey prey n/a Hairy1 1386065 unspecified role unspecified role bait bait physical association physical association false false false 2 sap18-hairy1-1 1386062 n/a Sap18 1386066 unspecified role unspecified role prey prey n/a Hairy1 1386065 unspecified role unspecified role bait bait hairy1_c-term required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false 2 Hairy1 associate with Sap18 through the C-terminal domain hairy1-sap18-3 1386063 n/a Sap18 1386066 unspecified role unspecified role bait bait sap18_35stag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sap18_hatag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a Hairy1 1386065 unspecified role unspecified role prey prey hairy1_35stag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false hairy1_c-myc_tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 3 Chick hairy1 and sap18 genes cloned in pGBKT7 and pGADT7 vectors, respectively, were used to generate 35S-labeled c-Myc-Hairy1 and HASap18 through in vitro transcription/translation reactions. hairy1-sap18-2 1386063 n/a Sap18 1386066 unspecified role unspecified role prey prey sap18_hatag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sap18_35stag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a Hairy1 1386065 unspecified role unspecified role bait bait hairy1_c-myc_tag myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false hairy1_35stag 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro direct interaction direct interaction false false false 3 Chick hairy1 and sap18 genes cloned in pGBKT7 and pGADT7 vectors, respectively, were used to generate 35S-labeled c-Myc-Hairy1 and HASap18 through in vitro transcription/translation reactions. sap18-hairy1-4 1386064 n/a Hairy1 1386065 unspecified role unspecified role bait bait hairy1_c-term required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a Sap18 1386066 unspecified role unspecified role prey prey physical association physical association false false false Hairy1 associate with Sap18 through the C-terminal domain