IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ qin-2006-1 Doppel-induced apoptosis and counteraction by cellular prion protein in neuroblastoma and astrocytes. mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells fluorescence imaging fluorescence microscopy fluorescence imaging immunocytochemistry immunocytochemistry Qin K., Zhao L., Tang Y., Bhatta S., Simard J.M., Zhao R.Y. RZhao@som.umaryland.edu Neuroscience (0306-4522) 2006 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. qin-2006-2 Doppel-induced apoptosis and counteraction by cellular prion protein in neuroblastoma and astrocytes. mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot Qin K., Zhao L., Tang Y., Bhatta S., Simard J.M., Zhao R.Y. RZhao@som.umaryland.edu Neuroscience (0306-4522) 2006 Only protein-protein interactions imex curation Neurodegeneration - Publications depicting interactions involved in neurodegenerative diseases. prio_mouse Major prion protein PrP27-30 PrP33-35C Prnp Prn-p Prp protein protein mouse Mus musculus Mouse MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG prnd_mouse Prion-like protein doppel Prnd Doppelganger PrPLP protein protein mouse Mus musculus Mouse MKNRLGTWWVAILCMLLASHLSTVKARGIKHRFKWNRKVLPSSGGQITEARVAENRPGAFIKQGRKLDIDFGAEGNRYYAANYWQFPDGIYYEGCSEANVTKEMLVTSCVNATQAANQAEFSREKQDSKLHQRVLWRLIKEICSAKHCDFWLERGAALRVAVDQPAMVCLLGFVWFIVK prnd-prnp 1475291 n/a 1475293 unspecified role unspecified role neutral component neutral component n/a 1475294 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false 6A prnd-prnp-2 1475292 n/a 1475294 unspecified role unspecified role bait bait n_terminus_protein_a_and_cbp_tag tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1475293 unspecified role unspecified role prey prey physical association physical association false false false 6B The protein A tag was cleaved by TEV, and this resulted in CBP-Dpl rather than TAP-Dpl being detected by an anti-Dpl antibody. The two bands of PrPC detected in the TAP pull down (lanes 3+4) correspond to differentially glycosylated -non- and mono-glycosylated proteins, both of which were efficiently depleted by expression of PrP RNAi.