UniProt UniProt http://www.uniprot.org oxenoid-2005-1 The structure of phospholamban pentamer reveals a channel-like architecture in membranes. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Oxenoid K., Chou J.J. chou@hms.harvard.edu james_chou@hms.harvard.edu Proc. Natl. Acad. Sci. U.S.A. (0027-8424) 2005 Only protein-protein interactions imex curation ppla_human Cardiac phospholamban PLN PLB protein protein human Homo sapiens Human MEKVQYLTRSAIRRASTIEMPQQARQKLQNLFINFCLILICLLLICIIVMLL pln-1 1385122 n/a 1385123 unspecified role unspecified role neutral component neutral component region 15n label 15n label 15N N15 15N N15 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) Stoichiometry: 5.0 direct interaction direct interaction false false false Fig 3 NMR structure, meaning no resolution and no R-factors