bhf-ucl cairo-2001-1 WBSCR14, a gene mapping to the Williams--Beuren syndrome deleted region, is a new member of the Mlx transcription factor network. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Cairo S., Merla G., Urbinati F., Ballabio A., Reymond A. Cardiac - Interactions involving cardiac related proteins The yeast two-hybrid experiment is performed according to the interaction-mating assays technology (citation by author PMID: 7566978) whereby the EGY42 strain expressing the LexA fusions to the bait proteins, were mated to EGY48 derivatives containing the B42 fusions to the prey proteins. The source of following proteins is human as stated by author: Mlx-alpha, Mlx-beta, Mlx-gamma, WBSCR14-alpha, Mnt and Mad1. The source of the following proteins is murine as stated by author: HA-Wbscr14-zeta and HA-Wbscr14-theta. The source of the following protein is endogenous to African Green Monkey Chlorocebus aethiops (Taxonomy ID 9534): Mlx. alexandre.reymond@medecine.unige.ch Hum. Mol. Genet. (0964-6906) 2001 imex curation Only protein-protein interactions cairo-2001-2 WBSCR14, a gene mapping to the Williams--Beuren syndrome deleted region, is a new member of the Mlx transcription factor network. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Cairo S., Merla G., Urbinati F., Ballabio A., Reymond A. Cardiac - Interactions involving cardiac related proteins The yeast two-hybrid experiment is performed according to the interaction-mating assays technology (citation by author PMID: 7566978) whereby the EGY42 strain expressing the LexA fusions to the bait proteins, were mated to EGY48 derivatives containing the B42 fusions to the prey proteins. The source of following proteins is human as stated by author: Mlx-alpha, Mlx-beta, Mlx-gamma, WBSCR14-alpha, Mnt and Mad1. The source of the following proteins is murine as stated by author: HA-Wbscr14-zeta and HA-Wbscr14-theta. The source of the following protein is endogenous to African Green Monkey Chlorocebus aethiops (Taxonomy ID 9534): Mlx. alexandre.reymond@medecine.unige.ch Hum. Mol. Genet. (0964-6906) 2001 imex curation Only protein-protein interactions cairo-2001-3 WBSCR14, a gene mapping to the Williams--Beuren syndrome deleted region, is a new member of the Mlx transcription factor network. chlae-cos_7 Cercopithecus aethiops simian cells transformed with SV40 Grivet cos_7 cercopithecus aethiops, by transformation with SV40 anti bait coip anti bait coimmunoprecipitation anti bait coip polyclonal western polyclonal antibody western blot polyclonal western Cairo S., Merla G., Urbinati F., Ballabio A., Reymond A. Cardiac - Interactions involving cardiac related proteins Author states that the N-terminal region of HA-Wbscr14-theta, used to produce the Wbscr14 antigen, is not conserved in HA-Wbscr14-zeta, explaining the weakness of the signal in lane 9. The yeast two-hybrid experiment is performed according to the interaction-mating assays technology (citation by author PMID: 7566978) whereby the EGY42 strain expressing the LexA fusions to the bait proteins, were mated to EGY48 derivatives containing the B42 fusions to the prey proteins. The source of following proteins is human as stated by author: Mlx-alpha, Mlx-beta, Mlx-gamma, WBSCR14-alpha, Mnt and Mad1. The source of the following proteins is murine as stated by author: HA-Wbscr14-zeta and HA-Wbscr14-theta. The source of the following protein is endogenous to African Green Monkey Chlorocebus aethiops (Taxonomy ID 9534): Mlx. alexandre.reymond@medecine.unige.ch Hum. Mol. Genet. (0964-6906) 2001 imex curation Only protein-protein interactions q9uh92-3 Max-like protein X MLX BHLHD13 TCFL4 Class D basic helix-loop-helix protein 13 Max-like bHLHZip protein Protein BigMax Transcription factor-like protein 4 protein protein human Homo sapiens Human MTEPGASPEDPWVKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY q9uh92-2 Max-like protein X MLX BHLHD13 TCFL4 Class D basic helix-loop-helix protein 13 Max-like bHLHZip protein Protein BigMax Transcription factor-like protein 4 protein protein human Homo sapiens Human MTEPGASPEDPWVKVEYAYSDNSLDPDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY mlxpl_human Carbohydrate-responsive element-binding protein MLXIPL Williams-Beuren syndrome chromosomal region 14 protein BHLHD14 MIO WBSCR14 Class D basic helix-loop-helix protein 14 MLX interactor MLX-interacting protein-like WS basic-helix-loop-helix leucine zipper protein protein protein human Homo sapiens Human MAGALAGLAAGLQVPRVAPSPDSDSDTDSEDPSLRRSAGGLLRSQVIHSGHFMVSSPHSDSLPRRRDQEGSVGPSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKIRLNNAIWRAWYIQYVKRRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIEVVMREYHKWRIYYKKRLRKPSREDDLLAPKQAEGRWPPPEQWCKQLFSSVVPVLLGDPEEEPGGRQLLDLNCFLSDISDTLFTMTQSGPSPLQLPPEDAYVGNADMIQPDLTPLQPSLDDFMDISDFFTNSRLPQPPMPSNFPEPPSFSPVVDSLFSSGTLGPEVPPASSAMTHLSGHSRLQARNSCPGPLDSSAFLSSDFLLPEDPKPRLPPPPVPPPLLHYPPPAKVPGLEPCPPPPFPPMAPPTALLQEEPLFSPRFPFPTVPPAPGVSPLPAPAAFPPTPQSVPSPAPTPFPIELLPLGYSEPAFGPCFSMPRGKPPAPSPRGQKASPPTLAPATASPPTTAGSNNPCLTQLLTAAKPEQALEPPLVSSTLLRSPGSPQETVPEFPCTFLPPTPAPTPPRPPPGPATLAPSRPLLVPKAERLSPPAPSGSERRLSGDLSSMPGPGTLSVRVSPPQPILSRGRPDSNKTENRRITHISAEQKRRFNIKLGFDTLHGLVSTLSAQPSLKVSKATTLQKTAEYILMLQQERAGLQEEAQQLRDEIEELNAAINLCQQQLPATGVPITHQRFDQMRDMFDDYVRTRTLHNWKFWVFSILIRPLFESFNGMVSTASVHTLRQTSLAWLDQYCSLPALRPTVLNSLRQLGTSTSILTDPGRIPEQATRAVTEGTLGKPL q9uh92-1 Max-like protein X MLX BHLHD13 TCFL4 Class D basic helix-loop-helix protein 13 Max-like bHLHZip protein Protein BigMax Transcription factor-like protein 4 protein protein human Homo sapiens Human MTEPGASPEDPWVKASPVGAHAGEGRAGRARARRGAGRRGASLLSPKSPTLSVPRGCREDSSHPACAKVEYAYSDNSLDPGLFVESTRKGSVVSRANSIGSTSASSVPNTDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY mnt_human Max-binding protein MNT MNT BHLHD3 ROX Protein ROX Myc antagonist MNT Class D basic helix-loop-helix protein 3 protein protein human Homo sapiens Human MSIETLLEAARFLEWQAQQQQRAREEQERLRLEQEREQEQKKANSLARLAHTLPVEEPRMEAPPLPLSPPAPPPAPPPPLATPAPLTVIPIPVVTNSPQPLPPPPPLPAAAQPLPLAPRQPALVGAPGLSIKEPAPLPSRPQVPTPAPLLPDSKATIPPNGSPKPLQPLPTPVLTIAPHPGVQPQLAPQQPPPPTLGTLKLAPAEEVKSSEQKKRPGGIGTREVHNKLEKNRRAHLKECFETLKRNIPNVDDKKTSNLSVLRTALRYIQSLKRKEKEYEHEMERLAREKIATQQRLAELKHELSQWMDVLEIDRVLRQTGQPEDDQASTSTASEGEDNIDEDMEEDRAGLGPPKLSHRPQPELLKSTLPPPSTTPAPLPPHPHPHPHSVALPPAHLPVQQQQPQQKTPLPAPPPPPAAPAQTLVPAPAHLVATAGGGSTVIAHTATTHASVIQTVNHVLQGPGGKHIAHIAPSAPSPAVQLAPATPPIGHITVHPATLNHVAHLGSQLPLYPQPVAVSHIAHTLSHQQVNGTAGLGPPATVMAKPAVGAQVVHHPQLVGQTVLNPVTMVTMPSFPVSTLKLA mint mad1_human Max dimerization protein 1 MAD Protein MAD MXD1 protein protein human Homo sapiens Human MAAAVRMNIQMLLEAADYLERREREAEHGYASMLPYNNKDRDALKRRNKSKKNNSSSRSTHNEMEKNRRAHLRLCLEKLKGLVPLGPESSRHTTLSLLTKAKLHIKKLEDCDRKAVHQIDQLQREQRHLKRQLEKLGIERIRMDSIGSTVSSERSDSDREEIDVDVESTDYLTGDLDWSSSSVSDSDERGSMQSLGSDEGYSSTSIKRIKLQDSHKACLGL q9np71-1 Carbohydrate-responsive element-binding protein Alpha MLXIPL BHLHD14 MIO WBSCR14 Class D basic helix-loop-helix protein 14 MLX interactor MLX-interacting protein-like WS basic-helix-loop-helix leucine zipper protein Williams-Beuren syndrome chromosomal region 14 protein protein protein human Homo sapiens Human MAGALAGLAAGLQVPRVAPSPDSDSDTDSEDPSLRRSAGGLLRSQVIHSGHFMVSSPHSDSLPRRRDQEGSVGPSDFGPRSIDPTLTRLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKIRLNNAIWRAWYIQYVKRRKSPVCGFVTPLQGPEADAHRKPEAVVLEGNYWKRRIEVVMREYHKWRIYYKKRLRKPSREDDLLAPKQAEGRWPPPEQWCKQLFSSVVPVLLGDPEEEPGGRQLLDLNCFLSDISDTLFTMTQSGPSPLQLPPEDAYVGNADMIQPDLTPLQPSLDDFMDISDFFTNSRLPQPPMPSNFPEPPSFSPVVDSLFSSGTLGPEVPPASSAMTHLSGHSRLQARNSCPGPLDSSAFLSSDFLLPEDPKPRLPPPPVPPPLLHYPPPAKVPGLEPCPPPPFPPMAPPTALLQEEPLFSPRFPFPTVPPAPGVSPLPAPAAFPPTPQSVPSPAPTPFPIELLPLGYSEPAFGPCFSMPRGKPPAPSPRGQKASPPTLAPATASPPTTAGSNNPCLTQLLTAAKPEQALEPPLVSSTLLRSPGSPQETVPEFPCTFLPPTPAPTPPRPPPGPATLAPSRPLLVPKAERLSPPAPSGSERRLSGDLSSMPGPGTLSVRVSPPQPILSRGRPDSNKTENRRITHISAEQKRRFNIKLGFDTLHGLVSTLSAQPSLKVSKATTLQKTAEYILMLQQERAGLQEEAQQLRDEIEELNAAINLCQQQLPATGVPITHQRFDQMRDMFDDYVRTRTLHNWKFWVFSILIRPLFESFNGMVSTASVHTLRQTSLAWLDQYCSLPALRPTVLNSLRQLGTSTSILTDPGRIPEQATRAVTEGTLGKPL q99mz3-2 Carbohydrate-responsive element-binding protein Theta Mlxipl Mio Wbscr14 MLX interactor MLX-interacting protein-like Williams-Beuren syndrome chromosomal region 14 protein homolog protein protein mouse Mus musculus Mouse MARALADLSVNLQVPRVVPSPDSDSDTDLEDPSPRRSAGGLHRSQVIHSGHFMVSSPRSIDPTLTHLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKIRLNNAIWRAWYIQYVQRRKSPVCGFVTPLQGSEADEHRKPEAVILEGNYWKRRIEVVMREYHKWRIYYKKRLRKSSREGDFLAPKQVEGGWPPPERWCEQLFSSVVPVLLGGSEEEPGGRQLLDLDCFLSDISDTLFTMTQPSPSSLQLPPEDAYVGNADMIQPDLTPLQPSLDDFMEISDFFTNYRPPQTPTSSNYIESPSFGPMADSLFSSGILAPEMPSPASSSSSSGMTPHSGNTRLQARNSCSGPLDPNPFLSSEFLLPEDPKTKIPPAPGPTPLLPFPTPVKVHGLEPCTPSPFPTMAPPPSLLPEESLLSARFPFTSAPPAPGVSTLPAPTTFVPTPQPGPGPVPFSVDHLPHGYLEPVFGPHFTVPQGMQPRCKPSSPSPGGQKASPPTLASATASPTATATARDNNPCLTQLLRAAKPEQALEPPTMPGTLLRPPESPQDTVSEIPRARAFFPPIPAPTPPRPPPGPATLAPPRSLVVPKAERLSPPASSGSERRLSGDLNSIQPSGALSVHLSPPQTVLSRGRVDNNKMENRRITHISAEQKRRFNIKLGFDTLHGLVSTLSAQPSLKVSKATTLQKTAEYILMLQQERAAMQEEAQQLRDEIEELNAAINLCQQQLPATGVPITHQRFDQMRDMFDDYVRTRTLHNWKFWVFSILIRPLFESFNGMVSTASLHSLRQTSLAWLEQYCSLPALRPTVLNSLRQLSTSTSILTDPSLVPEQATRAVTEGTLGRPL mlx_chlae_protein protein protein chlae Chlorocebus aethiops Cercopithecus aethiops Grivet Green monkey similar to Q9UH92 q99mz3-1 Carbohydrate-responsive element-binding protein Zeta Wbscr14 Mlxipl Mio MLX interactor MLX-interacting protein-like Williams-Beuren syndrome chromosomal region 14 protein homolog protein protein mouse Mus musculus Mouse MARALADLSVNLQVPRVVPSPDSDSDTDLEDPSPRRSAGGLHRSQVIHSGHFMVSSPHSDSLTRRRDQEGPVGLADFGPRSIDPTLTHLFECLSLAYSGKLVSPKWKNFKGLKLLCRDKIRLNNAIWRAWYIQYVQRRKSPVCGFVTPLQGSEADEHRKPEAVILEGNYWKRRIEVVMREYHKWRIYYKKRLRKSSREGDFLAPKQVEGGWPPPERWCEQLFSSVVPVLLGGSEEEPGGRQLLDLDCFLSDISDTLFTMTQPSPSSLQLPPEDAYVGNADMIQPDLTPLQPSLDDFMEISDFFTNYRPPQTPTSSNYIESPSFGPMADSLFSSGILAPEMPSPASSSSSSGMTPHSGNTRLQARNSCSGPLDPNPFLSSEFLLPEDPKTKIPPAPGPTPLLPFPTPVKVHGLEPCTPSPFPTMAPPPSLLPEESLLSARFPFTSAPPAPGVSTLPAPTTFVPTPQPGPGPVPFSVDHLPHGYLEPVFGPHFTVPQGMQPRCKPSSPSPGGQKASPPTLASATASPTATATARDNNPCLTQLLRAAKPEQALEPPTMPGTLLRPPESPQDTVSEIPRARAFFPPIPAPTPPRPPPGPATLAPPRSLVVPKAERLSPPASSGSERRLSGDLNSIQPSGALSVHLSPPQTVLSRGRVDNNKMENRRITHISAEQKRRFNIKLGFDTLHGLVSTLSAQPSLKVSKATTLQKTAEYILMLQQERAAMQEEAQQLRDEIEELNAAINLCQQQLPATGVPITHQRFDQMRDMFDDYVRTRTLHNWKFWVFSILIRPLFESFNGMVSTASLHSLRQTSLAWLEQYCSLPALRPTVLNSLRQLSTSTSILTDPSLVPEQATRAVTEGTLGRPL mlx-mlx-5 1457892 n/a 1457895 unspecified role unspecified role prey prey n/a 1457896 unspecified role unspecified role bait bait physical association physical association false false false Figure 3 A mlxipl-mlx 1457892 n/a 1457897 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 1457895 unspecified role unspecified role prey prey physical association physical association false false false Figure 3 A mlx-mlx-7 1457892 n/a 1457895 unspecified role unspecified role bait bait n/a 1457895 unspecified role unspecified role prey prey physical association physical association false false false Figure 3 A mlx-mlx-9 1457892 n/a 1457895 unspecified role unspecified role prey prey n/a 1457898 unspecified role unspecified role bait bait physical association physical association false false false Figure 3 A mnt-mlx 1457892 n/a 1457899 unspecified role unspecified role bait bait region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 1457895 unspecified role unspecified role prey prey physical association physical association false false false Figure 3 A mxd1-mlx 1457892 n/a 1457900 unspecified role unspecified role bait bait n/a 1457895 unspecified role unspecified role prey prey physical association physical association false false false Figure 3 A mlx-mlxipl-13 1457892 n/a 1457901 unspecified role unspecified role prey prey binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 1457895 unspecified role unspecified role bait bait physical association physical association false false false Figure 3 A mlx-mlxipl-9 1457892 n/a 1457896 unspecified role unspecified role bait bait n/a 1457901 unspecified role unspecified role prey prey binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 3 A mlx-mlxipl-11 1457892 n/a 1457901 unspecified role unspecified role prey prey binding region binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false n/a 1457898 unspecified role unspecified role bait bait physical association physical association false false false Figure 3 A mlx-mlxipl-4 1457893 n/a 1457902 unspecified role unspecified role prey prey cell lysate cell lysate ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1457903 unspecified role unspecified role bait bait cell lysate cell lysate physical association physical association false false false Figure 3B mlx-mlxipl-6 1457893 n/a 1457904 unspecified role unspecified role prey prey cell lysate cell lysate ha ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1457903 unspecified role unspecified role bait bait cell lysate cell lysate physical association physical association false false false Figure 3B mlx-mlxipl-7 1457894 n/a 1457904 unspecified role unspecified role prey prey cell lysate cell lysate ha ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1457903 unspecified role unspecified role bait bait cell lysate cell lysate physical association physical association false false false Figure 3B mlx-mlxipl-7 1457894 n/a 1457902 unspecified role unspecified role prey prey cell lysate cell lysate ha tag ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1457903 unspecified role unspecified role bait bait cell lysate cell lysate physical association physical association false false false Figure 3B