IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ naktinis-1995-1 Assembly of a chromosomal replication machine: two DNA polymerases, a clamp loader, and sliding clamps in one holoenzyme particle. II. Intermediate complex between the clamp loader and its clamp. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Naktinis V., Onrust R., Fang L., O'Donnell M. odonnel@rockefeller.edu J. Biol. Chem. (0021-9258) 1995 Only protein-protein interactions imex curation naktinis-1995-2 Assembly of a chromosomal replication machine: two DNA polymerases, a clamp loader, and sliding clamps in one holoenzyme particle. II. Intermediate complex between the clamp loader and its clamp. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Naktinis V., Onrust R., Fang L., O'Donnell M. odonnel@rockefeller.edu J. Biol. Chem. (0021-9258) 1995 Only protein-protein interactions imex curation naktinis-1995-3 Assembly of a chromosomal replication machine: two DNA polymerases, a clamp loader, and sliding clamps in one holoenzyme particle. II. Intermediate complex between the clamp loader and its clamp. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Naktinis V., Onrust R., Fang L., O'Donnell M. Participant Detection method for dpo3b (DnaN) = scintillation counting odonnel@rockefeller.edu J. Biol. Chem. (0021-9258) 1995 Only protein-protein interactions imex curation holc_ecoli DNA polymerase III subunit chi holC b4259 JW4216 protein protein ecoli Escherichia coli (strain K12) MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAYRLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSRRDILISLRTSFADFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNLNTATWK 7FEFFC359B28AA88 holb_ecoli DNA polymerase III subunit delta' holB b1099 JW1085 protein protein ecoli Escherichia coli (strain K12) MRWYPWLRPDFEKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLCQQPQGHKSCGHCRGCQLMQAGTHPDYYTLAPEKGKNTLGVDAVREVTEKLNEHARLGGAKVVWVTDAALLTDAAANALLKTLEEPPAETWFFLATREPERLLATLRSRCRLHYLAPPPEQYAVTWLSREVTMSQDALLAALRLSAGSPGAALALFQGDNWQARETLCQALAYSVPSGDWYSLLAALNHEQAPARLHWLATLLMDALKRHHGAAQVTNVDVPGLVAELANHLSPSRLQAILGDVCHIREQLMSVTGINRELLITDLLLRIEHYLQPGVVLPVPHL hold_ecoli DNA polymerase III subunit psi holD b4372 JW4334 protein protein ecoli Escherichia coli (strain K12) MTSRRDWQLQQLGITQWSLRRPGALQGEIAIAIPAHVRLVMVANDLPALTDPLVSDVLRALTVSPDQVLQLTPEKIAMLPQGSHCNSWRLGTDEPLSLEGAQVASPALTDLRANPTARAALWQQICTYEHDFFPRND dpo3x_ecoli DNA polymerase III subunit tau dnaX dnaZ dnaZX b0470 JW0459 DNA polymerase III subunit gamma protein protein ecoli Escherichia coli (strain K12) MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVGKTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEPRALQLLARAAEGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQALSLVEAMVEANGERVMALINEAAARGIEWEALLVEMLGLLHRIAMVQLSPAALGNDMAAIELRMRELARTIPPTDIQLYYQTLLIGRKELPYAPDRRMGVEMTLLRALAFHPRMPLPEPEVPRQSFAPVAPTAVMTPTQVPPQPQSAPQQAPTVPLPETTSQVLAARQQLQRVQGATKAKKSEPAAATRARPVNNAALERLASVTDRVQARPVPSALEKAPAKKEAYRWKATTPVMQQKEVVATPKALKKALEHEKTPELAAKLAAEAIERDPWAAQVSQLSLPKLVEQVALNAWKEESDNAVCLHLRSSQRHLNNRGAQQKLAEALSMLKGSTVELTIVEDDNPAVRTPLEWRQAIYEEKLAQARESIIADNNIQTLRRFFDAELDEESIRPI dpo3b_ecoli Beta sliding clamp dnaN Beta-clamp processivity factor DNA polymerase III beta sliding clamp subunit JW3678 b3701 protein protein ecoli Escherichia coli (strain K12) MKFTVEREHLLKPLQQVSGPLGGRPTLPILGNLLLQVADGTLSLTGTDLEMEMVARVALVQPHEPGATTVPARKFFDICRGLPEGAEIAVQLEGERMLVRSGRSRFSLSTLPAADFPNLDDWQSEVEFTLPQATMKRLIEATQFSMAHQDVRYYLNGMLFETEGEELRTVATDGHRLAVCSMPIGQSLPSHSVIVPRKGVIELMRMLDGGDNPLRVQIGSNNIRAHVGDFIFTSKLVDGRFPDYRRVLPKNPDKHLEAGCDLLKQAFARAAILSNEKFRGVRLYVSENQLKITANNPEQEEAEEILDVTYSGAEMEIGFNVSYVLDVLNALKCENVRMMLTDSVSSVQIEDAASQSAAYVVMPMRL This sequence has been withdrawn from Uniprot. hola_ecoli DNA polymerase III subunit delta b0640 holA JW0635 protein protein ecoli Escherichia coli (strain K12) MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAVRQVAAAQGFEEHHTFSIDPNTDWNAIFSLCQAMSLFASRQTLLLLLPENGPNAAINEQLLTLTGLLHDDLLLIVRGNKLSKAQENAAWFTALANRSVQVTCQTPEQAQLPRWVAARAKQLNLELDDAANQVLCYCYEGNLLALAQALERLSLLWPDGKLTLPRVEQAVNDAAHFTPFHWVDALLMGKSKRALHILQQLRLEGSEPVILLRTLQRELLLLVNLKRQSAHTPLRALFDKHRVWQNRRGMMGEALNRLSQTQLRQAVQLLTRTELTLKQDYGQSVWAELEGLSLLLCHKPLADVFIDG 87239A678FE16BE2 clamp-loading complex - hexamer 1340554 n/a 1340557 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1340558 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1340559 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1340560 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1340561 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1340562 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association false false false Fig.s 1a, 5e S/U beta is sliding clamp, S/Us gamma, delta, delta', chi & psi make up clamp loader - all part of DNA Polymerase III complex clamp-loading complex - tetramer 1340554 n/a 1340560 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1340562 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1340561 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1340558 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1b clamp-loading complex - trimer 1340554 n/a 1340560 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1340559 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1340557 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 1c dnan-hola 1340554 n/a 1340561 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1340562 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association false false false Fig. 2c, 5a, 5b this interaction is independent of ATP and MgCl2, ATP and MgCl2 are both needed for the full complex to form (see Fig. 5e+f) hola-dnan 1340555 n/a 1340562 unspecified role unspecified role bait bait ecoli Escherichia coli (strain K12) n/a 1340561 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) direct interaction direct interaction false false false Fig. 6a,b dnaN and dnaX (dpo3x) interact independently of the presence of ATP and MgCl2 when there rest of the gamma complex is missing (cf. Fig. 6c, d for binding to full gamma complex). In Fig.s 6c & d the rest of the gamma compound (dnaX, holB, holC and holD) were added after holA was immobilied and before dnaN was added. clamp-loading complex - hexamer 1340556 n/a 1340558 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1340559 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1340561 unspecified role unspecified role neutral component neutral component region 3h radiolabel 3h radiolabel 3H tritium H3 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) n/a 1340562 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1340557 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) n/a 1340560 unspecified role unspecified role neutral component neutral component ecoli Escherichia coli (strain K12) physical association physical association false false false Fig.s 8a, 8e binding of DnaN, holC and holD to the rest of the gamma-complex requires ATP and MgCl2 in the buffer (cf. Fig. 5f, other panels of Fig. 8) S/U beta is sliding clamp, S/Us gamma, delta, delta', chi & psi make up clamp loader - all part of DNA Polymerase III complex