MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint bao-2013-1 Direct interactions between bidensovirus BmDNV-Z proteins and midgut proteins from the virus target Bombyx mori. yeast Saccharomyces cerevisiae Baker's yeast two hybrid pooling two hybrid pooling approach two hybrid pooling experimental particp experimental participant identification experimental particp Bao YY., Chen LB., Wu WJ., Zhao D., Wang Y., Qin X., Zhang CX. FEBS J. (1742-464X) 2013 bao-2013-2 Direct interactions between bidensovirus BmDNV-Z proteins and midgut proteins from the virus target Bombyx mori. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid experimental particp experimental participant identification experimental particp Bao YY., Chen LB., Wu WJ., Zhao D., Wang Y., Qin X., Zhang CX. FEBS J. (1742-464X) 2013 bao-2013-3 Direct interactions between bidensovirus BmDNV-Z proteins and midgut proteins from the virus target Bombyx mori. ecoli Escherichia coli (strain K12) bifc bimolecular fluorescence complementation bifc experimental particp experimental participant identification experimental particp Bao YY., Chen LB., Wu WJ., Zhao D., Wang Y., Qin X., Zhang CX. FEBS J. (1742-464X) 2013 q5uan9_bommo 692715 RpS5 protein protein bommo Bombyx mori Silk moth MAEENWNDDVAEAGSVVVETMSLPQAADIPEIKLFGRWSCYDVQVSDMSLQDYISVKEKYAKYLPHSAGRYAHKRFRKAQCPIVERLTNSLMMHGRNNGKKLMAVRIVKHAFEIIHLLTGENPLQVLVTAIINSGPREDSTRIGRAGTVRRQAVDVSPLRRVNQAIWLLCTGAREAAFRNIKTIAECVADELINAAKGSSNSYAIKKKDELERVAKSNR mint q4u3c6_bmdnd protein protein bmdnv-3 Bombyx mori densovirus 3 (isolate Silkworm/China/Zhenjiang/-) MAFNALNRPSKWSITLLNEDCEITPDDLRVLVATLTGLDIRAVPGEENPVIVKKNGIEVKFPYTIKRDNLKAKLADIEHLISLNVLNSSLTSEEREKADDLLSRIRKRKAADEVEAGSSAKSSKIL mint q4u3c5_bmdnd protein protein bmdnv-3 Bombyx mori densovirus 3 (isolate Silkworm/China/Zhenjiang/-) MESKSNFRILSNEIISKPSSLISNISSPSTSLIPRSLQKSAKRLTISSLESGNGKQQMKSKLAQVQRALRFCRDYNIVKYYQFMDIPPEEYRELRTHCSKDVLETAADINYQEYYYEEVNNRLQVFLSYGDGSWGEEEEEIVMLFKHNNVDISKFCEALYSIFTMSDYRKNCIFLNGNIKTGKTLMMRLITGNFKCVGKGCNNGVNSEFYYQKFIGRSICVLEEPFLDPQTLEDFKSIFGGEGFDISCKFHNPQTLNRTPFIITSNFSLLSRGHAPSISEMAIKDRFYIFNFNNSYTPKCKLSPKNFVNVYNKYYG mint q9bmq7_bommo protein protein bommo Bombyx mori Silk moth MAGKMAVAYLIGILYTVSLVQGNPVNAGSEAIIEDLRNTDRQSRIVAGWPAEDAQIPHQISLRMVSPVGGVSSCGGSIIHHEWVLTAAHCLANRINFVVRLGLTNLTRPDYLVETTHKFIHPRYIEILGGVQTDDIALVKLNHHIPYSRYIQPCRLQNSEQKNINYEGAIFTVSGYGRTDDPWNGGVASEILLWVHLRGITNEQCLTHYPNSRVIQEQTLCAAYYNDTAQSSCQGDSGGPLTIVDEDGQPTMVGVVSFGHRDGCNSPHPSAYVRPGHYHEWFYEVTGINFDWSSEDLKPIVLAEAQDDVIAAE mint c4b7z7_bommo protein protein bommo Bombyx mori Silk moth MFTIDFHDERITSFNKNQTRKIIICVITGGRTSCESARVGTTTLPISASEDVCMTLYSCGWETRFDLNTRKCIILMLCRALRPVSIRTIFRSVSLTTLTGVFQQAYALFNLLNAVWN mint q4u3c3_bmdnd DNA-directed DNA polymerase protein protein bmdnv-3 Bombyx mori densovirus 3 (isolate Silkworm/China/Zhenjiang/-) MIRKPFCNFKMPLVKITEDTPATPGYYYSTSKDELASFLEKVLDNTPIGQLSVSFHVAGSFLKDDERKIIHTTPDVFNIHSDGIIPIDVQIDNFIEDYLDPEKSSFSKYSGSGFSLQVILSYWVNIVPYSPNNIAVPTSRNTQDYRDGTPAPIELNLSSSIRRNFIGVIAQHFTEPGYTKSGKVKSTYPLEVIEEFIKQRGFERYAELAVNVSTIPAIHAELNEFNIIIWSITGIPIYAKILGEVDEVPIHMLKKGDNLHLIRSIRAFLNENKTNQNRVFCTLCKKFHIPNACNITGEIICIDDIKDNEKDKGLISPISKPKIIYPNTKHCLVAYADFEAIIDNNIHKPASYSLIPIIAGDPPAENFIFTKSVLNLEDEVFNEDGEIIKFDNIIEMFLTDLYSIIKKFQTNDYGKEANLIDEAGERFKCLACNKNKKGKYYYARHYGLGIFGYYCRSCFLAHNNTFIVYFHNFKGYDHHILLEQLLNKDSKHNTCRGKSINKMDVITHKDILSDFIRITFKDTFNFLPESLASLANKLTTLKYTPDKFKEAFNSGKGEFPYEWFDDFNKLEEIEVPQDPADWDSRLTNKKGTEEIIKKANQIWIDNNMQIFHDYVLLYNELDVWLLLEVFEAFRDTTVNEDKIDPVYFDGAPGLTFYLARMYENSLDMHVIPDKNVYLDVSRNIRGGVTQVVTKYANIEDVDETIVYLDVNTMYSYCMKQKLANKYLGTLDALPDNYDSDDNFCYFIKGDFSYPEYLHDLPAHLSMPLMPHQYNNKLCTTFLDKKDMLIHSKVFKYYLSKGLVCDKIHYVYKFKQEYIIKDYVETNIQKRNSSTDPGTKDYYKLKNNALFGKTCENVFKYKIFSVTNVNSGDRENKCMSKAKSHITLGNCILYEECVTRYLLDKPIQIGFTILELAKLMIYEFIYELFDVIPEGSTATMLYTDTDSVIFKFKGFNGVHPYKYLLTTSLASKLDIPINKDGSFGSATKTPGLWSDDTKYKTITEFIGLRAKQYAYSIANDRDILKHKGIPKNALKDDNNPMNVNDFRNVLFEMKDLTVNIAQIRATKNVLTSTVSKKLALSTKDNKRITYTDKVTTLPFGYKGELYSNYMDDVVIE mint q9xy10_bommo protein protein bommo Bombyx mori Silk moth MAYRTVVIFLVAFVGGQALADDTDFTFPEIARDRSLPGSRIVSGWEASEGQFPYQLSIRMVSTVGGVNACGATIIHSNWGLTAAHCTGLRVTIIVRAGAVNLTRPGLLFETTKYINHPEYSENLNVVQPHDIGLIDFGRKIEFNDYIQPIRLQRSADKNRNYDNVRLVASGWGRTWTGGSSPENLNWVFLNGISNLRCMVAYNFSPTIQPSTICTLGYNDTTQSTCQGDSGGPLTVIDEDGQITQVGVTSFVSSEGCHVDIPSGFIRPGHYLDWFKTVTGLDFDWTPSTPEAPETTEAPGTTEAPDTSTETDTSNLLF mint c7emf0_bommo Alpha-amylase Amy protein protein bommo Bombyx mori Silk moth MFRYILLLSAVTLALAYKNPHYASGRTTMVHLFEWKWDDIAAECERFLGPRGFGGIQVSPPNENLVIWSRNRPWWERYQPISYRLVTRSGNENQFSNMVRRCNNVGVRIYVDAIINHMTGTWNENVGTGGSTANFENWHYPAVPYGRNDFNWPHCVITGSDYNCCPDRVRNCELSGLKDLNQGSDYVRQQILNYMNRLIDMGVAGFRIDAAKHMWPHDLRVIYDRLRNLNTAHGFPSGARPYIYQEVIDLGGEAISRNEYTPLAAVTEFRFGLELSQAFQRRNQLRWLVNWGPQWGLLASGDALTFIDNHDNQRGHGAGGNILTYKQSRQYKGAIAFMLAHPYGYPQLMSSFAFTDTEAGPPMNSRGDITSPTINADNSCGNGWICEHRWRQIHNMVVFRNTAGNGALTNWWDNGSNQIAFCRGNQAFIAFNNDAWDMDQTLQTCLPAGTYCDIISGARSGNRCTGKSIVVGSDGRALIIHRSNEYDMMVAIHRGADSRL mint h9bvm5_bommo protein protein bommo Bombyx mori Silk moth MNIKYGILFVALFAAAWALPKPEDDMSIFYEHVDRNARIVGGSQAAQGSHPHMVAMTNGIFIRSFVCGGSVLTARSVLTAAHCIVAVFTLGSLSGNLRLTVGTNQWNSGGSLHTVSRNITHPHYVSNTIKNDLGILITSSNIVFNNRVRPISLSFDYVPGGVPVRVAGWGRVRANGALSTNLLEINVRTIDGQTCVRTAAQAAIDLNVRAPPVEPHIELCTLHAEGTGTCNGDSGSALARTDSGLQVGIVSWGFPCARGAPDMFVRVSAFRSWLQQNIS mint h9bvm4_bommo protein protein bommo Bombyx mori Silk moth MLFKTLIFFCFAGASLAYRSYENYKVYNVVPTSEIHIQMLGDLKKAGYDFWTDILTIGGNARVMVAPEQEQEFANYALSVGLKPNVTISNVQALINSQLQPATNARSSTLGSFSWDRYYSLAQIHSWLDELVTLYPGVVTTMVIGTSFEGRELKGIVIDFKKGERGNNPLIGMIEGGIHSREWISPATVTWIIKEFLTSDDPDVRFLAETFIWHIVPVTNPDGYTYTFSEDRMWRKNRNPVNYVPCATGNLDLGNGIDLNRNFNFLWMTTGASSNPCTQTYAGPSPSSELEAQAISNYVLRLKETGNFLYYFAFHSYSQMILVPYSHVSGQNVLEASNYADMYEIAIRGAEKLTARHGTQYQVGTSADILYEVSGSSFDWVKGVADIPIVYLFELRDVGEFGFLLPSEQIIPNNEEIMDCLVEMDKTTRQLSYYSGTVPMYASFISLATSILFLILMK mint ef2_bommo Translation elongation factor 2 tef2 protein protein bommo Bombyx mori Silk moth MVNFTVDEIRGMMDKKRNIRNMSVIAHVDHGKSTLTDSLVSKAGIIAGARAGETRFTDTRKDEQDRCITIKSTAISMFFELEEKDLVFITNPDQREKSEKGFLINLIDSPGHVDFSSEVTAALRVTDGALVVVDCVSGVCVQTETVLRQAIAERIKPILFMNKMDRALLELQLEAEELYQTFQRIVENVNVIIATYNDDGGPMGEVRVDPSKGSVGFGSGLHGWAFTLKQFSEMYADKFKIDLVKLMNRLWGENFFNPQTKKWSKQKDDDNKRSFCMYVLDPIYKVFDAIMKFKKEEIDDLLKKIGVTIKHEDSDKDGKALLKVVMRSWLPAGEALLQMIAIHLPSPVVAQKYRMEMLYEGPHDDEAAIGIKSCDPEAPLMMYVSKMVPTSDKGRFYAFGRVFSGKVVTGQKARIMGPNFTPGKKEDLYEKTIQRTILMMGRYVEAIEDVPSGNICGLVGVDQFLVKTGTITTFKNAHNMKVMKFSVSPVVRVAVEPKNPADLPKLVEGLKRLAKSDPMVQCINEESGEHIVAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVAEESDQLCLSKSPNKHNRLFMKAQPMPDGLPEDIDEGRVNPRDDFKTRARYLTEKYEYDVTEARKIWCFGPEGTGPNILVDCSKGVQYLNEIKDSVVAGFQWAAKEGVMAEENLRGVRFNIYDVTLHTDAIHRGGGQIIPTTRRCLYACLLTAQPRLMEPVYLCEIQCPEVAVGGIYGVLNRRRGHVFEESQVAGTPMFIVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQVLPGDPCEPQSKPYNVVQETRKRKGLKEGLPDLTQYLDKL mint q1hpt9_bommo protein protein bommo Bombyx mori Silk moth MVSVLTLAVAVLAAVCSCTASDLGRPVSIGEHPSLVQIEVFLPILNQWFQQCAGIVLTNYHYLSTATCFHGEFYDPAYRRIIAGSSRRSEPGEISYVHFAVNHPEFSEENYDKDVSIVRVTHAIHFGPNIQQGAIIQQGVVIPQGIFVDLLGWGTTVQGGSVSDGNLHKLELIVTNKENCREQYKGHDRVVTDNKFCAGLVRAGGRDYDNTDLGAPAFFQNALVGIVSFGKSNANDIYPVVLTSISSFTEWILQNVH mint q4u3c2_bmdnd protein protein bmdnv-3 Bombyx mori densovirus 3 (isolate Silkworm/China/Zhenjiang/-) MNLKRLYVFCAVITAINSLSQSDLIQIRELIETNIIRLSKTFNGDISTINNFYRILVSVFELFNDLLVELDTPAVSNQLQLFEDEDTVPNDCLGIVGQMLIEYTDIPNDGSLTYLNIGTISSLTVTLDNQLYLILTVIYNNGRETIQEVHNTGSPTIVVDFYEIKHNNTFQEIKTSIYYVNFINFVLEYTVHEIEDIIVTRNINRYNQWSTQQRSRSRIAFIQQEAIDPDIRNEQLQESAILAKLHDAADTLEYYGISFLREYYIAYFQYTIYAETQKLDPEFYDDPLEKNVIYINRIVQALWRQ mint q4u3c0_bmdnd protein protein bmdnv-3 Bombyx mori densovirus 3 (isolate Silkworm/China/Zhenjiang/-) MLRLTDLHKPSCEPKGLSFYAYKAFIPYREKLSKEWNKLPVCIKDQEVDIKQEVKEDQLIRKIYKWDSVFDSWNWSKGYKLPKPLYELLEIYMKLWKLDNRTTYPDWGESSMIFKCYRYIRNKRMEDIENLSTEEFNDSNFNGWPKTMWYICRNCFDNGIVINNNSNDYYYTCDFSDNPTLLHYTDYFYYILNNDYWCYDCKYTPLFTLTTLFCLESINDSE mint o01953_bommo SP1 692357 protein protein bommo Bombyx mori Silk moth MKVFAAVLMALAAVVVAEEPIELDYHIKIGIPRAESLRRAEEAADFDGTRIVGGSAANAGAHPHLAGLVIALTNGRTSICGASLLTNTRSVTAAHCWRTRRAQARQFTLALGTANIFSGGTRVTTSNVQMHGSYNMDTLHNDVAIINHNHVGFTNNIQRINLASGSNNFAGTWAWAAGFGRTSDAASGANNQQKRQVSLQVITNAVCARTFGNNVIIASTLCVDGSNGRSTCSGDSGGPLTIGSGGSRQLIGITSFGSAQGCQRGHPAGFARVTSFNSWIRARI mint q1hq70_bommo Transgelin protein protein bommo Bombyx mori Silk moth MANNRATKSGFAAEAQRKINSKYSEELAHESLEWIRMITGEPENTSGDMDNFYEVLKDGTLLCKLANNIHPNMIKKINTSSMAFKCMENINAFLEAARQLGVPAQETFQTVDLWERQNLNSVVICLQSLGRKAGTYGKPSIGPKEAEKNVRNFSEEQLRAGQGVISLQYGSNKGANQSGINFGNTRHM mint o92407_npvbm p47 protein protein bmnpv Bombyx mori nuclear polyhedrosis virus MFVTRLEHTTQFLPQACKLEDEVLVLYAIYLNGFDYTLPRFVKREVQVNADGFLRFDYNIKIFDFARFTDMTQATPEDIDDYINLTRIDSLSDHDLKMLQLVCRDRWYKGDVARLRRILQQKDVDDLVKFACNVMWERAYENHYTLGQQLSIRITTKLIQSGLDFKHQPDTTAPVSVRGWEDATFEKYLQSITSISEVIKRHVFSKKYICLEVAASYWSDTVESLQQENFRIILNSKTPYVLLIEMDDDKNSMVYLRKLAHMLENKIVNLLFVTDVEFYFKNGNFMFYLYNSLKFYYYCLKNKFAFESADKEIFFLLYTIVALEWFNGGHLNSFTLEKSALYNPLELSTRRLNSIKRAAQHNRVINCDSEINMDYIRGKRVRTGAHYGKRVVNFDQSLY mint homomint o92427_npvbm lef-9 protein protein bmnpv Bombyx mori nuclear polyhedrosis virus MFSFLDKTPTEFDLILDLHKLQNVAFFTNEEFKVILKNFITDLKKNQKLNYFNSLIDQLINVYTDTSAKNTQPDVLAKIIKSTCVIVTDLPSNVFLKKLKTNKFTDTINYLILPHFILWDHNFVIFLNKAFNSKHENNLVDISGALQKIKLTHGVIKDQLQRKNGYAVQYLYSTFLNTASFYANVQCLNGVNEIMPPRSSVKRYYGRDVDNVRAWTTRHPNISQLSTQVSDVHINESSTDWNVKVGLGIFPGANTDCDGDKKIITFLPKPNSLIDSECLLYGDPRFNFICFDKNRLSFVSQQIYYLYKNIDAMEALFKSTPLVYALWQKHKHEQFAQRLEMLLRDFCLIASSNASYLLFKQLTQLIANEEMVCGDEEIFNLGGQFVDMIESGAKGSQNLIKSTQQYRQTLNTDIETVSLRATTSLNSYISSHNKVKVCGADIYHNTVVLQSVFIKNNYVCYKNDERTIMNICALPSEFLFPEHLLDMFIE mint homomint q4u3c6-rps5 1340593 ribosomal protein s5 ribosomal protein S5 1340596 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bmdnv vd1-orf1 BmDNV VD1-ORF1 1340597 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 mint q4u3c5-q9bmq7 1340593 bmdnv vd1-orf2 BmDNV VD1-ORF2 1340598 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 35 kda protease 35 kDa protease 1340599 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 mint q4u3c5-c4b7z7 1340593 olfactory receptor olfactory receptor 1340600 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bmdnv vd1-orf2 BmDNV VD1-ORF2 1340598 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 mint q4u3c3-q9xy10 1340593 bmdnv vd1-orf4 BmDNV VD1-ORF4 1340601 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 30 kp protease a 30 kP protease A 1340602 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 mint q4u3c3-amy 1340593 alpha amylase alpha amylase 1340603 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bmdnv vd1-orf4 BmDNV VD1-ORF4 1340601 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 mint q4u3c3-h9bvm5 1340593 bmdnv vd1-orf4 BmDNV VD1-ORF4 1340601 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false chymotrypsin-like pr chymotrypsin-like protein 1340604 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 mint q4u3c3-h9bvm4 1340593 bmdnv vd1-orf4 BmDNV VD1-ORF4 1340601 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false carboxypeptidase carboxypeptidase 1340605 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 mint q4u3c3-tef2 1340593 translation elongati translation elongation factor 2 1340606 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bmdnv vd1-orf4 BmDNV VD1-ORF4 1340601 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 mint q4u3c3-c4b7z7 1340593 olfactory receptor olfactory receptor 1340600 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bmdnv vd1-orf4 BmDNV VD1-ORF4 1340601 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 mint q4u3c3-q1hpt9 1340593 bmdnv vd1-orf4 BmDNV VD1-ORF4 1340601 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trypsin-like proteas trypsin-like protease 1340607 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 mint q4u3c3-q9bmq7 1340593 bmdnv vd1-orf4 BmDNV VD1-ORF4 1340601 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 35 kda protease 35 kDa protease 1340599 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 mint q4u3c2-q9bmq7 1340593 bmdnv vd2-orf1 BmDNV VD2-ORF1 1340608 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 35 kda protease 35 kDa protease 1340599 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 mint q4u3c2-rps5 1340593 bmdnv vd2-orf1 BmDNV VD2-ORF1 1340608 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ribosomal protein s5 ribosomal protein S5 1340596 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 mint q4u3c0-loc692357 1340593 bmdnv vd2-orf3 BmDNV VD2-ORF3 1340609 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false serine protease prec serine protease precursor 1340610 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 mint q4u3c0-q1hq70 1340593 bmdnv vd2-orf3 BmDNV VD2-ORF3 1340609 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false transgelin transgelin 1340611 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 mint rps5-q4u3c6 1340594 ribosomal protein s5 ribosomal protein S5 1340596 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bmdnv vd1-orf1 BmDNV VD1-ORF1 1340597 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 F1 mint q9bmq7-q4u3c5 1340594 bmdnv vd1-orf2 BmDNV VD1-ORF2 1340598 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 35 kda protease 35 kDa protease 1340599 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 F1 mint c4b7z7-q4u3c5 1340594 olfactory receptor olfactory receptor 1340600 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bmdnv vd1-orf2 BmDNV VD1-ORF2 1340598 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 F1 mint q9xy10-q4u3c3 1340594 bmdnv vd1-orf4 BmDNV VD1-ORF4 1340601 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 30 kp protease a 30 kP protease A 1340602 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 F1 mint h9bvm4-q4u3c3 1340594 carboxypeptidase carboxypeptidase 1340605 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bmdnv vd1-orf4 BmDNV VD1-ORF4 1340601 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 F1 mint tef2-q4u3c3 1340594 bmdnv vd1-orf4 BmDNV VD1-ORF4 1340601 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false translation elongati translation elongation factor 2 1340606 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 F1 mint q1hpt9-q4u3c3 1340594 bmdnv vd1-orf4 BmDNV VD1-ORF4 1340601 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false trypsin-like proteas trypsin-like protease 1340607 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 F1 mint loc692357-q4u3c0 1340594 bmdnv vd2-orf3 BmDNV VD2-ORF3 1340609 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false serine protease prec serine protease precursor 1340610 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 F1 mint q1hq70-q4u3c0 1340594 transgelin transgelin 1340611 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bmdnv vd2-orf3 BmDNV VD2-ORF3 1340609 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false T1 F1 mint q4u3c5-q9bmq7-1 1340595 35 kda protease 35 kDa protease 1340599 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bmdnv vd1-orf2 BmDNV VD1-ORF2 1340598 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F4A mint q4u3c2-q9bmq7-1 1340595 bmdnv vd2-orf1 BmDNV VD2-ORF1 1340608 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false 35 kda protease 35 kDa protease 1340599 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F4B mint loc692357-q4u3c0-1 1340595 serine protease prec serine protease precursor 1340610 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bmdnv vd2-orf3 BmDNV VD2-ORF3 1340609 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F4C mint q1hq70-q4u3c0-1 1340595 bmdnv vd2-orf3 BmDNV VD2-ORF3 1340609 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false transgelin transgelin 1340611 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false F4D mint lef_9-p47 1340595 bmnpv p47 BmNPV P47 1340612 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false bmnpv lef-9 BmNPV LEF-9 1340613 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false homomint mint F4E