MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint wiemuth-2012-1 Transient receptor potential N (TRPN1) from Xenopus interacts with the penta-EF-hand protein peflin. yeast Saccharomyces cerevisiae Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid experimental particp experimental participant identification experimental particp Wiemuth D., van de Sandt L., Herr R., Gründer S. FEBS Lett. (0014-5793) 2012 wiemuth-2012-2 Transient receptor potential N (TRPN1) from Xenopus interacts with the penta-EF-hand protein peflin. in vitro In vitro pull down pull down experimental particp experimental participant identification experimental particp Wiemuth D., van de Sandt L., Herr R., Gründer S. FEBS Lett. (0014-5793) 2012 wiemuth-2012-3 Transient receptor potential N (TRPN1) from Xenopus interacts with the penta-EF-hand protein peflin. pig-cl4 Sus scrofa cl4 cl4 fluorescence imaging fluorescence microscopy fluorescence imaging experimental particp experimental participant identification experimental particp Wiemuth D., van de Sandt L., Herr R., Gründer S. FEBS Lett. (0014-5793) 2012 pef1_xenla Peflin pef1 PEF protein with a long N-terminal hydrophobic domain Penta-EF hand domain-containing protein 1 protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MASYPYGQGYHGAAGQPPGAPQTNYYGGQQYGGGVQPAASYGRPAPGAPYGSPPSGGVYGHPVPGSAAPGAPGGPYGGQAPGGPYSVPGSTPYGSQQHGSYGQGAPAGNIPPGVDPEAFSWFQTVDTDHSGYISLKELKQALVNTNWSSFNDETCTMMMNMFDKSNSGRIDMFGFSALWRFIQQWRNLFQQYDRDRSGSINQGELHQALCQMGYQLSPQFVQIVMSRYAQRSAQPGLQLDRFIQICTQLQSMTEAFREKDTGQIGTAKLSYEDFITMTTTRLL mint q4a520_xenla XB5813854.L XB5813854 XB5813854.L [provisional:ankrd52] nompC protein protein xenla Xenopus laevis (African clawed frog) African clawed frog MSLQDCLTALHVAAAHSKDEIVRLLLKKAEPNIPGGPKDQLPLHYTALRPNGAINVTQTLLRASHKDARLTPDKDGCIPLFLAIEAGNLGICKELLLVNPESQLRAVSKKYGDTALHASCRKRDVDAAKLLVEYGANVDCQNDEGQTPLHIVAWAGDEMMLKFLHQCKTNANITDKMERTPLHVAAERGNTNVVEILTEKFRSNVLARTKDGNTLMHIASQCGHPETALAFLKRGVLLHMPNKSGAVCLHAAAKRGHTAVVKALLQKGAHVDARTKDNYTALHVAAENCKPQVVQTLLGFGAQVQLKGGKAQETPLHVAARIKDGEKVAEMLIKSGADINVEQENGETAMHISAQHGNLKMITALIEEGGEPTWQSKNQENPLHTAVRHCHLPIVEVLLQHLINERGRADAVGCVNQANKAGETSLHLAAAVKKEMIHTKEEDVKIIGILMEHDGDISRPTNTTLETPLHYCARVGNEDVLLEMIRHISSSRMQQTMNKQAKNGRSPLLVAAEQGHTGIVRILLQNQARVDVFDEHGKAALHLAAENGHDKIADILLKHKAFVNAKTKLGLTPLHLCAQNGFNHLVKLLVGTHSASIDAMALTKRTPLHMAALNGQLDVCNSLLNMKADVNATDIEGQTPLHLAAENDHSEVVKVFLKHKPELVTSANMEGSTCAHIAASKGSAAVIKELLKFNKTGVTTARNKTNDSTPLHLAAAGGHTDVVKVLLETGALASDENGEGMTAIHLAAKNGHINVLEALKGSVSFRITSTKTGFTALHVAAHFGQLDFVREILTKVPATMTSEPPKAVPDLLHMKEQRGESGYTPLHLASQSGHESLVRLLLNYPGVQADTATTRQGSTPIHLAAQNGHTAVVGLLLSKSTSQLHMKDKRGRTCLHLAAANGHIEMMRALIGQGAEINVTDKNGWCPLHFAARSGFLDTVRFLVECGANPTLECKDGKTAIQYAAAKNHQDVVSFLLKKNHNTLKLIEDRKFVFDLMVCGKLNDNRIIQEFILNSSAPLDTAVKLSRALNITAFKEKERAMDLLNAAKYSENMATELLTIASGSTNAGFILRAVDHRCTTILDCLIECEQKDVVAHPAVQKYLTEVWYGNLDWTTWKLVLLFFTFLACPPVWLVFSLPLKHRFNKIPIMKFMSYLASHIFLIVLFILTIVYPPLSPIYEGHMVPCWNEWLLLAWLSGMLVSELTHHGERAGLAWIRVFVLGFSAAAFFCHLLAFLFSDRDRLHCLFARNILLGMAMTLSFVQFLEFLTFHHLFGPWAIIIRDLIKDLTRFAVILALFHVAFTMQLSAVYQPVYPDDTATQSLNETETVHSESNIQDPIDITVLLFFSLFGLVEPGCLPSLNRTPQFTFVIVRFVFGVYLIVTLIVLINLLIAMMSDTYQRIQAQSDTEWKFGRATLIRDMTRKPGTPSPFNLFTNLFYYIKLLCKHKGKLCSANARNLMSEEDIDGFSDTRSIDLLAQTSLSWIRTPAKRTMQVAPEGKNLHVLRVLLFCIPVNVKGKFST mint nompc-pef1 1323559 pef1_xenla Peflin 1323562 nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cdna library cdna library fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q4a520_xenla TRPN1 1323563 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false mint nf nompc-pef1-1 1323559 q4a520_xenla TRPN1 1323563 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pef1_xenla Peflin 1323562 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f1b mint nompc-pef1-2 1323559 pef1_xenla Peflin 1323562 predetermined predetermined participant predetermined unspecified role unspecified role prey prey over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q4a520_xenla TRPN1 1323563 predetermined predetermined participant predetermined unspecified role unspecified role bait bait over-expressed over expressed level over-expressed living cell living cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f1b mint nompc-pef1-3 1323560 q4a520_xenla TRPN1 1323563 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pef1_xenla Peflin 1323562 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f2b mint nompc-pef1-4 1323560 q4a520_xenla TRPN1 1323563 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false pef1_xenla Peflin 1323562 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false f3a mint nompc-pef1-5 1323560 pef1_xenla Peflin 1323562 anti tag western anti tag western blot anti tag western unspecified role unspecified role prey prey over-expressed over expressed level over-expressed cell lysate cell lysate gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false q4a520_xenla TRPN1 1323563 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified gst tag gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false f3b mint nompc-pef1-6 1323561 pef1_xenla Peflin 1323562 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q4a520_xenla TRPN1 1323563 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false colocalization colocalization false false false mint f4b f4c f4d f6 sf2c nompc-pef1-7 1323561 q4a520_xenla TRPN1 1323563 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell rfp tag rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false pef1_xenla Peflin 1323562 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f5 mint