MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint derache-2012-1 Crystal structure of greglin, a novel non-classical Kazal inhibitor, in complex with subtilisin. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction experimental particp experimental participant identification experimental particp Derache C., Epinette C., Roussel A., Gabant G., Cadene M., Korkmaz B., Gauthier F., Kellenberger C. FEBS J. (1742-464X) 2012 spi_schgr Greglin protein protein desert locust Schistocerca gregaria Gryllus gregarius SEDDGSASPESQEMSYTELPCPSICPLIYAPVCVEDSNQDFYLFVNECEVRKCGCEAGFVYTFVPREMCKATTSLCPMQTKSS mint subc_bacli Subtilisin Carlsberg subC apr protein protein bacli Bacillus licheniformis MMRKKSFWLGMLTAFMLVFTMAFSDSASAAQPAKNVEKDYIVGFKSGVKTASVKKDIIKESGGKVDKQFRIINAAKAKLDKEALKEVKNDPDVAYVEEDHVAHALAQTVPYGIPLIKADKVQAQGFKGANVKVAVLDTGIQASHPDLNVVGGASFVAGEAYNTDGNGHGTHVAGTVAALDNTTGVLGVAPSVSLYAVKVLNSSGSGSYSGIVSGIEWATTNGMDVINMSLGGASGSTAMKQAVDNAYAKGVVVVAAAGNSGSSGNTNTIGYPAKYDSVIAVGAVDSNSNRASFSSVGAELEVMAPGAGVYSTYPTNTYATLNGTSMASPHVAGAAALILSKHPNLSASQVRNRLSSTATYLGSSFYYGKGLINVEAAAQ Subtilisin is an extracellular alkaline serine protease, it catalyzes the hydrolysis of proteins and peptide amides mint apr-spi 1321426 spi_schgr Greglin 1321427 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified subt_bacli Subtilisin Carlsberg 1321428 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false mint t1 f1 sf6