IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ ou-2012-1 A Structural Basis for the Assembly and Functions of a Viral Polymer that Inactivates Multiple Tumor Suppressors. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference confocal microscopy confocal microscopy anti-tag immunocytochemistry anti-tag immunocytochemistry Ou H.D., Kwiatkowski W., Deerinck T.J., Noske A., Blain K.Y., Land H.S., Soria C., Powers C.J., May A.P., Shu X., Tsien R.Y., Fitzpatrick J.A., Long J.A., Ellisman M.H., Choe S., O'Shea C.C. Colocalisation data relating to LaminA/C could not be captured as origin of construct could not be traced. oshea@salk.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation ou-2012-2 A Structural Basis for the Assembly and Functions of a Viral Polymer that Inactivates Multiple Tumor Suppressors. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Ou H.D., Kwiatkowski W., Deerinck T.J., Noske A., Blain K.Y., Land H.S., Soria C., Powers C.J., May A.P., Shu X., Tsien R.Y., Fitzpatrick J.A., Long J.A., Ellisman M.H., Choe S., O'Shea C.C. Colocalisation data relating to LaminA/C could not be captured as origin of construct could not be traced. oshea@salk.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation ou-2012-3 A Structural Basis for the Assembly and Functions of a Viral Polymer that Inactivates Multiple Tumor Suppressors. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Ou H.D., Kwiatkowski W., Deerinck T.J., Noske A., Blain K.Y., Land H.S., Soria C., Powers C.J., May A.P., Shu X., Tsien R.Y., Fitzpatrick J.A., Long J.A., Ellisman M.H., Choe S., O'Shea C.C. Colocalisation data relating to LaminA/C could not be captured as origin of construct could not be traced. oshea@salk.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation ou-2012-4 A Structural Basis for the Assembly and Functions of a Viral Polymer that Inactivates Multiple Tumor Suppressors. human-u2-os Human U2-OS osteosarcoma cell line u2-os U2-OS osteocaroma cell line Not in CAPRI and no primary literature reference scanning electron microscopy scanning electron microscopy sem sem tag visualisation tag visualisation Ou H.D., Kwiatkowski W., Deerinck T.J., Noske A., Blain K.Y., Land H.S., Soria C., Powers C.J., May A.P., Shu X., Tsien R.Y., Fitzpatrick J.A., Long J.A., Ellisman M.H., Choe S., O'Shea C.C. MiniSOG (singlet oxygen generator) is a fluorescent 106-residue protein tag with which to visualize proteins by correlated light and EM. Fluorescence photo-oxidation of miniSOG catalyzes the local formation of an electron-dense polymer on the surface of the fusion protein that can be detected by EM. Colocalisation data relating to LaminA/C could not be captured as origin of construct could not be traced. oshea@salk.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation ou-2012-5 A Structural Basis for the Assembly and Functions of a Viral Polymer that Inactivates Multiple Tumor Suppressors. human-epithelium Homo sapiens epithelium/epithelial cells epithelium Epithelium [epithelial cells] confocal microscopy confocal microscopy immunocytochemistry immunocytochemistry Ou H.D., Kwiatkowski W., Deerinck T.J., Noske A., Blain K.Y., Land H.S., Soria C., Powers C.J., May A.P., Shu X., Tsien R.Y., Fitzpatrick J.A., Long J.A., Ellisman M.H., Choe S., O'Shea C.C. Colocalisation data relating to LaminA/C could not be captured as origin of construct could not be traced. oshea@salk.edu Cell (0092-8674) 2012 Only protein-protein interactions imex curation e411_ade05 Probable early E4 11 kDa protein protein protein ade05 Human adenovirus C serotype 5 (HAdV-5) HAdV-5 Human adenovirus 5 MIRCLRLKVEGALEQIFTMAGLNIRDLLRDILRRWRDENYLGMVEGAGMFIEEIHPEGFSLYVHLDVRAVCLLEAIVQHLTNAIICSLAVEFDHATGGERVHLIDLHFEVLDNLLE nbn_human Nibrin Nijmegen breakage syndrome protein 1 Cell cycle regulatory protein p95 NBN NBS1 NBS P95 protein protein human Homo sapiens Human MWKLLPAAGPAGGEPYRLLTGVEYVVGRKNCAILIENDQSISRNHAVLTANFSVTNLSQTDEIPVLTLKDNSKYGTFVNEEKMQNGFSRTLKSGDGITFGVFGSKFRIEYEPLVACSSCLDVSGKTALNQAILQLGGFTVNNWTEECTHLVMVSVKVTIKTICALICGRPIVKPEYFTEFLKAVESKKQPPQIESFYPPLDEPSIGSKNVDLSGRQERKQIFKGKTFIFLNAKQHKKLSSAVVFGGGEARLITEENEEEHNFFLAPGTCVVDTGITNSQTLIPDCQKKWIQSIMDMLQRQGLRPIPEAEIGLAVIFMTTKNYCDPQGHPSTGLKTTTPGPSLSQGVSVDEKLMPSAPVNTTTYVADTESEQADTWDLSERPKEIKVSKMEQKFRMLSQDAPTVKESCKTSSNNNSMVSNTLAKMRIPNYQLSPTKLPSINKSKDRASQQQQTNSIRNYFQPSTKKRERDEENQEMSSCKSARIETSCSLLEQTQPATPSLWKNKEQHLSENEPVDTNSDNNLFTDTDLKSIVKNSASKSHAAEKLRSNKKREMDDVAIEDEVLEQLFKDTKPELEIDVKVQKQEEDVNVRKRPRMDIETNDTFSDEAVPESSKISQENEIGKKRELKEDSLWSAKEISNNDKLQDDSEMLPKKLLLTEFRSLVIKNSTSRNPSGINDDYGQLKNFKKFKKVTYPGAGKLPHIIGGSDLIAHHARKNTELEEWLRQEMEVQNQHAKEESLADDLFRYNPYLKRRR e411-e411 1331395 n/a 1331400 unspecified role unspecified role neutral component neutral component n-terminal flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1331400 unspecified role unspecified role neutral component neutral component P04489:p.Asn82Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false P04489:p.[Cys71Ser;Asn82Ala;Cys86Ser] mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n-terminal myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false colocalization colocalization false false false Fig. 1C, 1E, 3C-F, 4D, Supp Fig. 1C e411-1 1331396 n/a 1331400 unspecified role unspecified role neutral component neutral component P04489:p.[Cys71Ser;Asn82Ala;Cys86Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false P04489:p.Asn82Ala mutation mutation certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Supp. Fig. 1A, 1B e411-1 1331397 n/a 1331400 unspecified role unspecified role neutral component neutral component P04489:p.[Cys71Ser;Asn82Ala;Cys86Ser] mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false n-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false ecoli Escherichia coli (strain K12) Stoichiometry: 2.0 direct interaction direct interaction false false false Fig. 2 2.05A Rworking = 0.21 Rfree = 0.26 e411-1 1331398 n/a 1331400 unspecified role unspecified role neutral component neutral component single oxygen generator minisog fusion protein fusion protein certain certain sequence position certain certain certain sequence position certain false n/a 1331400 unspecified role unspecified role neutral component neutral component single oxygen generator minisog fusion protein fusion protein certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false Fig. 5, Supp. Fig. 4B e411-nbn 1331399 n/a 1331401 unspecified role unspecified role neutral component neutral component n/a 1331400 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig. 6C