mpidb The Microbial Protein Interaction Database plocinski-2012-1 Mycobacterium tuberculosis CwsA Interacts with CrgA and Wag31, and the CrgA-CwsA Complex Is Involved in Peptidoglycan Synthesis and Cell Shape Determination. ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Plocinski P., Arora N., Sarva K., Blaszczyk E., Qin H., Das N., Plocinska R., Ziolkiewicz M., Dziadek J., Kiran M., Gorla P., Cross T.A., Madiraju M., Rajagopalan M. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation plocinski-2012-2 Mycobacterium tuberculosis CwsA Interacts with CrgA and Wag31, and the CrgA-CwsA Complex Is Involved in Peptidoglycan Synthesis and Cell Shape Determination. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Plocinski P., Arora N., Sarva K., Blaszczyk E., Qin H., Das N., Plocinska R., Ziolkiewicz M., Dziadek J., Kiran M., Gorla P., Cross T.A., Madiraju M., Rajagopalan M. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation cwsa_myctu Cell wall synthesis protein CwsA cwsA Cell wall synthesis and cell shape protein A MTCY10H4.07c Rv0008c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MSEQVETRLTPRERLTRGLAYSAVGPVDVTRGLLELGVGLGLQSARSTAAGLRRRYREGRLAREVAAAQETLAQELTAAQDVVANLPQALQDARTQRRSKHHLWIFAGIAAAILAGGAVAFSIVRRSSRPEPSPRPPSVEVQPRS wag31_myctu Cell wall synthesis protein Wag31 wag31 Antigen 84 ag84 MTCY270.23 Rv2145c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MPLTPADVHNVAFSKPPIGKRGYNEDEVDAFLDLVENELTRLIEENSDLRQRINELDQELAAGGGAGVTPQATQAIPAYEPEPGKPAPAAVSAGMNEEQALKAARVLSLAQDTADRLTNTAKAESDKMLADARANAEQILGEARHTADATVAEARQRADAMLADAQSRSEAQLRQAQEKADALQADAERKHSEIMGTINQQRAVLEGRLEQLRTFEREYRTRLKTYLESQLEELGQRGSAAPVDSNADAGGFDQFNRGKN crga_myctu Cell division protein CrgA crgA MTCY10H4.11c Rv0011c protein protein myctu Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) MPKSKVRKKNDFTVSAVSRTPMKVKVGPSSVWFVSLFIGLMLIGLIWLMVFQLAAIGSQAPTALNWMAQLGPWNYAIAFAFMITGLLLTMRWH ag84-y008 1340337 not-defined-32331817 1340339 unspecified role unspecified role prey prey not-defined-332128251 1340340 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 5 y008-ag84 1340337 not-defined-2114989570 1340339 unspecified role unspecified role bait bait not-defined-689966709 1340340 unspecified role unspecified role prey prey physical association physical association false false false figure 5 y011-y011-1 1340337 not-defined-1929719581 1340341 unspecified role unspecified role bait bait not-defined-1476126343 1340341 unspecified role unspecified role prey prey physical association physical association false false false figure 1B y008-y011 1340337 not-defined-1133099987 1340339 unspecified role unspecified role bait bait not-defined-1852776407 1340341 unspecified role unspecified role prey prey physical association physical association false false false figure 1B y008-y008-1 1340337 not-defined-642957077 1340339 unspecified role unspecified role bait bait not-defined-1402618850 1340339 unspecified role unspecified role prey prey physical association physical association false false false figure 1B, 5 y011-y008-1 1340338 not-defined-1564222329 1340339 unspecified role unspecified role prey prey not-defined-59336769 1340341 unspecified role unspecified role bait bait p67376-- P67376-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 1 y008-y011-1 1340338 not-defined-1394479642 1340341 unspecified role unspecified role prey prey not-defined-1671927927 1340339 unspecified role unspecified role bait bait p71577-- P71577-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 1A