MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint b_nyai-2012-2 Characterization of a Wnt-binding site of the WIF-domain of Wnt inhibitory factor-1. in vitro In vitro competition binding competition binding predetermined predetermined participant predetermined Bányai L., Kerekes K., Patthy L. FEBS Lett. (0014-5793) 2012 b_nyai-2012-1 Characterization of a Wnt-binding site of the WIF-domain of Wnt inhibitory factor-1. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Bányai L., Kerekes K., Patthy L. FEBS Lett. (0014-5793) 2012 wif1_human Wnt inhibitory factor 1 WIF1 UNQ191/PRO217 protein protein human Homo sapiens Human MARRSAFPAAALWLWSILLCLLALRAEAGPPQEESLYLWIDAHQARVLIGFEEDILIVSEGKMAPFTHDFRKAQQRMPAIPVNIHSMNFTWQAAGQAEYFYEFLSLRSLDKGIMADPTVNVPLLGTVPHKASVVQVGFPCLGKQDGVAAFEVDVIVMNSEGNTILQTPQNAIFFKTCQQAECPGGCRNGGFCNERRICECPDGFHGPHCEKALCTPRCMNGGLCVTPGFCICPPGFYGVNCDKANCSTTCFNGGTCFYPGKCICPPGLEGEQCEISKCPQPCRNGGKCIGKSKCKCSKGYQGDLCSKPVCEPGCGAHGTCHEPNKCQCQEGWHGRHCNKRYEASLIHALRPAGAQLRQHTPSLKKAEERRDPPESNYIW wnt5a_mouse Protein Wnt-5a Wnt5a Wnt-5a protein protein mouse Mus musculus Mouse MKKPIGILSPGVALGTAGGAMSSKFFLMALATFFSFAQVVIEANSWWSLGMNNPVQMSEVYIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRGKLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVCK wnt3a_mouse Protein Wnt-3a Wnt3a Wnt-3a protein protein mouse Mus musculus Mouse MAPLGYLLVLCSLKQALGSYPIWWSLAVGPQYSSLSTQPILCASIPGLVPKQLRFCRNYVEIMPSVAEGVKAGIQECQHQFRGRRWNCTTVSNSLAIFGPVLDKATRESAFVHAIASAGVAFAVTRSCAEGSAAICGCSSRLQGSPGEGWKWGGCSEDIEFGGMVSREFADARENRPDARSAMNRHNNEAGRQAIASHMHLKCKCHGLSGSCEVKTCWWSQPDFRTIGDFLKDKYDSASEMVVEKHRESRGWVETLRPRYTYFKVPTERDLVYYEASPNFCEPNPETGSFGTRDRTCNVSSHGIDGCDLLCCGRGHNARTERRREKCHCVFHWCCYVSCQECTRVYDVHTCK wnt4_mouse Protein Wnt-4 Wnt4 Wnt-4 protein protein mouse Mus musculus Mouse MSPRSCLRSLRLLVFAVFSAAASNWLYLAKLSSVGSISEEETCEKLKGLIQRQVQMCKRNLEVMDSVRRGAQLAIEECQYQFRNRRWNCSTLDSLPVFGKVVTQGTREAAFVYAISSAGVAFAVTRACSSGELEKCGCDRTVHGVSPQGFQWSGCSDNIAYGVAFSQSFVDVRERSKGASSSRALMNLHNNEAGRKAILTHMRVECKCHGVSGSCEVKTCWRAVPPFRQVGHALKEKFDGATEVEPRRVGSSRALVPRNAQFKPHTDEDLVYLEPSPDFCEQDIRSGVLGTRGRTCNKTSKAIDGCELLCCGRGFHTAQVELAERCGCRFHWCCFVKCRQCQRLVEMHTCR wnt7a_human Protein Wnt-7a WNT7A protein protein human Homo sapiens Human MNRKARRCLGHLFLSLGMVYLRIGGFSSVVALGASIICNKIPGLAPRQRAICQSRPDAIIVIGEGSQMGLDECQFQFRNGRWNCSALGERTVFGKELKVGSREAAFTYAIIAAGVAHAITAACTQGNLSDCGCDKEKQGQYHRDEGWKWGGCSADIRYGIGFAKVFVDAREIKQNARTLMNLHNNEAGRKILEENMKLECKCHGVSGSCTTKTCWTTLPQFRELGYVLKDKYNEAVHVEPVRASRNKRPTFLKIKKPLSYRKPMDTDLVYIEKSPNYCEEDPVTGSVGTQGRACNKTAPQASGCDLMCCGRGYNTHQYARVWQCNCKFHWCCYVKCNTCSERTEMYTCK wnt9b_mouse Protein Wnt-9b Wnt9b Wnt14b Wnt15 Protein Wnt-14b Protein Wnt-15 protein protein mouse Mus musculus Mouse MRPAPALALAALCLLVLPAAAAAAAYFGLTGREVLTPFPGLGTAAAPAQAGAHLKQCDLLKLSRRQKQLCRREPGLAETLRDAAHLGLLECQFQFRQERWNCSLEGRTGLLQRGFKETAFLYAVSAAALTHALARACSAGRMERCTCDDSPGLESRQAWQWGVCGDNLKYSTKFLSNFLGPKRGSKDLRARADAHNTHVGIKAVKSGLRTTCKCHGVSGSCAVRTCWKQLSPFRETGQVLKLRYDTAVKVSSATNEALGRLELWAPAKPGGPAKGLAPRPGDLVYMEDSPSFCRPSKYSPGTAGRVCSRDSSCSSLCCGRGYDTQSRMVVFSCHCQVQWCCYVECQQCAQQELVYTCKR mint wnt11_human Protein Wnt-11 WNT11 protein protein human Homo sapiens Human MRARPQVCEALLFALALQTGVCYGIKWLALSKTPSALALNQTQHCKQLEGLVSAQVQLCRSNLELMHTVVHAAREVMKACRRAFADMRWNCSSIELAPNYLLDLERGTRESAFVYALSAAAISHAIARACTSGDLPGCSCGPVPGEPPGPGNRWGGCADNLSYGLLMGAKFSDAPMKVKKTGSQANKLMRLHNSEVGRQALRASLEMKCKCHGVSGSCSIRTCWKGLQELQDVAADLKTRYLSATKVVHRPMGTRKHLVPKDLDIRPVKDSELVYLQSSPDFCMKNEKVGSHGTQDRQCNKTSNGSDSCDLMCCGRGYNPYTDRVVERCHCKYHWCCYVTCRRCERTVERYVCK mint homomint Ligand for members of the frizzled family of seven transmembrane receptors. Probable developmental protein. May be a signaling molecule which affects the development of discrete regions of tissues. Is likely to signal over only few cell diameters wif1-wnt5a-1 1310362 wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false wnt5a_mouse Wnt-5a 1310365 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association false false false t2 homomint mint wif1-wnt5a-2 1310362 wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q9Y5W5:p.Trp15Arg mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false wnt5a_mouse Wnt-5a 1310365 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association false false false t2 homomint mint wif1-wnt5a-3 1310362 wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false wnt5a_mouse Wnt-5a 1310365 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association false false false homomint mint t2 f2 wif1-wnt5a-4 1310362 wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false wnt5a_mouse Wnt-5a 1310365 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified physical association physical association false false false homomint mint t2 f2 wif1-wnt5a-5 1310362 wnt5a_mouse Wnt-5a 1310365 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false homomint mint t2 wif1-wnt5a-6 1310362 wnt5a_mouse Wnt-5a 1310365 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false homomint mint t2 wif1-wnt3a-1 1310362 wnt3a_mouse Wnt3a 1310366 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false t2 mint wif1-wnt3a-2 1310362 wnt3a_mouse Wnt3a 1310366 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q9Y5W5:p.Trp15Arg mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false t2 mint wif1-wnt3a-3 1310362 wnt3a_mouse Wnt3a 1310366 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false t2 mint wif1-wnt3a-4 1310362 wnt3a_mouse Wnt3a 1310366 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false t2 mint wif1-wnt3a-5 1310362 wnt3a_mouse Wnt3a 1310366 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false t2 mint wif1-wnt3a-6 1310362 wnt3a_mouse Wnt3a 1310366 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false undefined mutation mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false t2 mint wif1-wnt5a 1310363 wnt5a_mouse Wnt5a 1310365 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1310363 homomint mint t1 f1 f2 wif1-wnt3a 1310363 wnt3a_mouse Wnt3a 1310366 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1310363 mint t1 wif1-wnt4 1310363 wnt4_mouse Wnt4 1310367 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1310363 homomint mint t1 wif1-wnt7a 1310363 wnt7a_human Wnt7a 1310368 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1310363 homomint mint t1 wif1-wnt9b 1310363 wnt9b_mouse Wnt9b 1310369 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1310363 mint t1 wif1-wnt11 1310363 wnt11_human Wnt11 1310370 predetermined predetermined participant predetermined unspecified role unspecified role prey prey purified purified wnt inhibitory facto WIF 1310364 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1310363 homomint mint t1