MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint may-2012-1 The P1/P2 proteins of the human ribosomal stalk are required for ribosome binding and depurination by ricin in human cells. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined May KL., Li XP., Martínez-Azorín F., Ballesta JP., Grela P., Tchórzewski M., Tumer NE. FEBS J. (1742-464X) 2012 may-2012-2 The P1/P2 proteins of the human ribosomal stalk are required for ribosome binding and depurination by ricin in human cells. in vitro In vitro anti bait coip anti bait coimmunoprecipitation anti bait coip predetermined predetermined participant predetermined May KL., Li XP., Martínez-Azorín F., Ballesta JP., Grela P., Tchórzewski M., Tumer NE. FEBS J. (1742-464X) 2012 rici_ricco Ricin protein protein castor bean Ricinus communis Castor bean MKPGGNTIVIWMYAVATWLCFGSTSGWSFTLEDNNIFPKQYPIINFTTAGATVQSYTNFIRAVRGRLTTGADVRHEIPVLPNRVGLPINQRFILVELSNHAELSVTLALDVTNAYVVGYRAGNSAYFFHPDNQEDAEAITHLFTDVQNRYTFAFGGNYDRLEQLAGNLRENIELGNGPLEEAISALYYYSTGGTQLPTLARSFIICIQMISEAARFQYIEGEMRTRIRYNRRSAPDPSVITLENSWGRLSTAIQESNQGAFASPIQLQRRNGSKFSVYDVSILIPIIALMVYRCAPPPSSQFSLLIRPVVPNFNADVCMDPEPIVRIVGRNGLCVDVRDGRFHNGNAIQLWPCKSNTDANQLWTLKRDNTIRSNGKCLTTYGYSPGVYVMIYDCNTAATDATRWQIWDNGTIINPRSSLVLAATSGNSGTTLTVQTNIYAVSQGWLPTNNTQPFVTTIVGLYGLCLQANSGQVWIEDCSSEKAEQQWALYADGSIRPQQNRDNCLTSDSNIRETVVKILSCGPASSGQRWMFKNDGTILNLYSGLVLDVRASDPSLKQIILYPLHGDPNQIWLPLF mint rla2_human 60S acidic ribosomal protein P2 RPLP2 RPP2 D11S2243E Renal carcinoma antigen NY-REN-44 Large ribosomal subunit protein P2 protein protein human Homo sapiens Human MRYVASYLLAALGGNSSPSAKDIKKILDSVGIEADDDRLNKVISELNGKNIEDVIAQGIGKLASVPAGGAVAVSAAPGSAAPAAGSAPAAAEEKKDEKKEESEESDDDMGFGLFD rla1_human 60S acidic ribosomal protein P1 RPLP1 RRP1 Large ribosomal subunit protein P1 protein protein human Homo sapiens Human MASVSELACIYSALILHDDEVTVTEDKINALIKAAGVNVEPFWPGLFAKALANVNIGSLICNVGAGGPAPAAGAAPAGGPAPSTAAAPAEEKKVEAKKEESEESDDDMGFGLFD rici-rplp1 1313944 ricin RTA 1313946 predetermined predetermined participant predetermined unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ricin a chain Ricin A chain polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false rla2_human P2 1313947 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified rla1_human P1 1313948 predetermined predetermined participant predetermined unspecified role unspecified role unspecified role unspecified role purified purified physical association physical association false false false f5a mint rici-rplp1-1 1313945 ricin RTA 1313946 western blot western blot Immuno blot Immuno blot unspecified role unspecified role bait bait purified purified ricin a chain Ricin A chain polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false rla1_human P1 1313948 western blot western blot Immuno blot Immuno blot unspecified role unspecified role unspecified role unspecified role purified purified rla2_human P2 1313947 western blot western blot Immuno blot Immuno blot unspecified role unspecified role unspecified role unspecified role purified purified physical association physical association false false false f5b mint