mpidb The Microbial Protein Interaction Database de_francesc-2012-2 Physical interaction between coat morphogenetic proteins SpoVID and CotE is necessary for spore encasement in Bacillus subtilis. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot de Francesco M., Jacobs J.Z., Nunes F., Serrano M., McKenney P.T., Chua M.H., Henriques A.O., Eichenberger P. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation de_francesc-2012-1 Physical interaction between coat morphogenetic proteins SpoVID and CotE is necessary for spore encasement in Bacillus subtilis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined de Francesco M., Jacobs J.Z., Nunes F., Serrano M., McKenney P.T., Chua M.H., Henriques A.O., Eichenberger P. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation sp6d_bacsu Stage VI sporulation protein D spoVID BSU28110 protein protein bacsu Bacillus subtilis MPQNHRLQFSVEESICFQKGQEVSELLSISLDPDIRVQEVNDYVSIIGSLELTGEYNIDQNKHTEEIYTDKRFVEQVRKREDGSAELTHCFPVDITIPKNKVSHLQDVFVFIDAFDYQLTDSRILTIQADLAIEGLLDDTQDKEPEIPLYEAPAAFREEELSEPPAHSVVEEPGASSAEEAVLQHEPPAEPPELFISKAGLREELETEKAESEPPESVASEPEAREDVKEEEESEELAVPETEVRAESETEESEPEPDPSEIEIQEIVKAKKETAEPAAAIADVREEADSPAETELREHVGAEESPALEAELHSETVIAKEKEETTVSPNHEYALRQEAQNEEAAQSDQADPALCQEEAEPDEALESVSEAALSIEDSRETASAVYMENDNADLHFHFNQKTSSEEASQEELPEPAYRTFLPEQEEEDSFYSAPKLLEEEEQEEESFEIEVRKTPSAEEPKEETPFQSFQLPESSETERKETDAVPRVAPAAETKEPQTKESDNSLYLTKLFTKEADEFSRMKICIVQQEDTIERLCERYEITSQQLIRMNSLALDDELKAGQILYIPQYKNSHA cote_bacsu Spore coat protein E cotE BSU17030 protein protein bacsu Bacillus subtilis MSEYREIITKAVVAKGRKFTQCTNTISPEKKPSSILGGWIINHKYDAEKIGKTVEIEGYYDINVWYSYADNTKTEVVTERVKYVDVIKLRYRDNNYLDDEHEVIAKVLQQPNCLEVTISPNGNKIVVQAEREFLAEVVGETKVVVEVNPDWEEDDEEDWEDELDEELEDINPEFLVGDPEE safa_bacsu SpoIVD-associated factor A safA Morphogenetic protein SafA yrbA BSU27840 protein protein bacsu Bacillus subtilis MKIHIVQKGDSLWKIAEKYGVDVEEVKKLNTQLSNPDLIMPGMKIKVPSEGVPVRKEPKAGKSPAAGSVKQEHPYAKEKPKSVVDVEDTKPKEKKSMPYVPPMPNLQENVYPEADVNDYYDMKQLFQPWSPPKPEEPKKHHDGNMDHMYHMQDQFPQQEAMSNMENANYPNMPNMPKAPEVGGIEEENVHHTVPNMPMPAVQPYYHYPAHFVPCPVPVSPILPGSGLCYPYYPAQAYPMHPMHGYQPGFVSPQYDPGYENQHHENSHHGHYGSYGAPQYASPAYGSPYGHMPYGPYYGTPQVMGAYQPAAAHGYMPYKDHDDCGCDGDHQPYFSAPGHSGMGAYGSPNMPYGTANPNPNPYSAGVSMPMTNQPSVNQMFGRPEEENE spovid-cote-1 1340006 not-defined-444218573 1340008 unspecified role unspecified role bait bait P37963:p.Leu131Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false region required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false P37963:p.Ile127Ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false p37963-- P37963-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) not-defined-1526669441 1340009 unspecified role unspecified role prey prey ecoli Escherichia coli (strain K12) physical association physical association false false false figure 3 spovid-safa 1340006 not-defined-1182238539 1340008 unspecified role unspecified role bait bait region P37963-131-131 his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) not-defined-709007783 1340010 unspecified role unspecified role prey prey o32062-1-162 O32062-1-162 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecoli Escherichia coli (strain K12) physical association physical association false false false figure 5 cote-spovid 1340007 not-defined-1024927635 1340009 unspecified role unspecified role bait bait region P14016-1-158 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false not-defined-1174135436 1340008 unspecified role unspecified role prey prey region P37963-1-144 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P37963:p.Leu131Ala P37963-131-131 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false 1340027 1340025 physical association physical association false false false figure 2