Molecular Connections Molecular Connections Pvt. Ltd. 2/2, Kariappa Road, Basavanagudi, Bangalore -560 004 www.molecularconnections.com www.molecularconnections.com war-2012-1 Coexpression of human somatostatin receptor-2(SSTR2) and SSTR3 modulates antiproliferative signaling and apoptosisosis. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot War S.A., Kumar U. ujkum ar@mail.ubc.ca ujkumar@mail.ubc.ca J Mol Signal 2012 Only protein-protein interactions imex curation war-2012-2 Coexpression of human somatostatin receptor-2(SSTR2) and SSTR3 modulates antiproliferative signaling and apoptosisosis. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret tag fluorescence tag visualisation by fluorescence tag fluorescence War S.A., Kumar U. ujkum ar@mail.ubc.ca ujkumar@mail.ubc.ca J Mol Signal 2012 Only protein-protein interactions imex curation war-2012-3 Coexpression of human somatostatin receptor-2(SSTR2) and SSTR3 modulates antiproliferative signaling and apoptosisosis. human-293t Homo sapiens 293 cells transformed with SV40 large T antigen 293t 293 cells expressing SV40 large T antigen. The original designation of this cell line was 293tsA1609neo. It is not in Cabri,ATCC or HyperCLDB. fluorescence imaging fluorescence microscopy fluorescence imaging immunostaining immunostaining War S.A., Kumar U. ujkum ar@mail.ubc.ca ujkumar@mail.ubc.ca J Mol Signal 2012 Only protein-protein interactions imex curation ssr3_human Somatostatin receptor type 3 SSTR3 SSR-28 protein protein human Homo sapiens Human MDMLHPSSVSTTSEPENASSAWPPDATLGNVSAGPSPAGLAVSGVLIPLVYLVVCVVGLLGNSLVIYVVLRHTASPSVTNVYILNLALADELFMLGLPFLAAQNALSYWPFGSLMCRLVMAVDGINQFTSIFCLTVMSVDRYLAVVHPTRSARWRTAPVARTVSAAVWVASAVVVLPVVVFSGVPRGMSTCHMQWPEPAAAWRAGFIIYTAALGFFGPLLVICLCYLLIVVKVRSAGRRVWAPSCQRRRRSERRVTRMVVAVVALFVLCWMPFYVLNIVNVVCPLPEEPAFFGLYFLVVALPYANSCANPILYGFLSYRFKQGFRRVLLRPSRRVRSQEPTVGPPEKTEEEDEEEEDGEESREGGKGKEMNGRVSQITQPGTSGQERPPSRVASKEQQLLPQEASTGEKSSTMRISYL ssr2_human Somatostatin receptor type 2 SSTR2 SRIF-1 protein protein human Homo sapiens Human MDMADEPLNGSHTWLSIPFDLNGSVVSTNTSNQTEPYYDLTSNAVLTFIYFVVCIIGLCGNTLVIYVILRYAKMKTITNIYILNLAIADELFMLGLPFLAMQVALVHWPFGKAICRVVMTVDGINQFTSIFCLTVMSIDRYLAVVHPIKSAKWRRPRTAKMITMAVWGVSLLVILPIMIYAGLRSNQWGRSSCTINWPGESGAWYTGFIIYTFILGFLVPLTIICLCYLFIIIKVKSSGIRVGSSKRKKSEKKVTRMVSIVVAVFIFCWLPFYIFNVSSVSMAISPTPALKGMFDFVVVLTYANSCANPILYAFLSDNFKKSFQNVLCLVKVSGTDDGERSDSKQDKSRLNETTETQRTLLNGDLQTSI sstr3-sstr2 1312236 n/a 1312239 unspecified role unspecified role bait bait n-terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1312240 unspecified role unspecified role prey prey physical association physical association false false false fig. 1a sstr2-sstr3-2 1312237 n/a 1312239 unspecified role unspecified role fluorescence donor fluorescence donor n_terminus ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1312240 unspecified role unspecified role fluorescence accept fluorescence acceptor fluorescence accept proximity proximity close-contact colocalization neighbourhood interaction false false false fig. 1b SST (Somatostatin), SSTR2-specific agonist L-779976 and SSTR3-specific agonist L-796778 - or in combination. sstr2-sstr3-1 1312238 n/a 1312240 unspecified role unspecified role neutral component neutral component n/a 1312239 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false fig.2 SSTR2 and SSTR3 display colocalization at the cell surface and internalize upon treatment with SST, L-779976 and L-796778.