MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint wong-2012-1 Identification of an amyloid fibril forming peptide comprising residues 46-59 of apolipoprotein A-I. in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Wong YQ., Binger KJ., Howlett GJ., Griffin MD. FEBS Lett. (0014-5793) 2012 wong-2012-2 Identification of an amyloid fibril forming peptide comprising residues 46-59 of apolipoprotein A-I. in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Wong YQ., Binger KJ., Howlett GJ., Griffin MD. FEBS Lett. (0014-5793) 2012 wong-2012-3 Identification of an amyloid fibril forming peptide comprising residues 46-59 of apolipoprotein A-I. in vitro In vitro x-ray fiber diffrac x-ray fiber diffraction X-ray X-ray x-ray fiber diffrac predetermined predetermined participant predetermined Wong YQ., Binger KJ., Howlett GJ., Griffin MD. FEBS Lett. (0014-5793) 2012 apoa1_human Apolipoprotein A-I APOA1 Apolipoprotein A1 protein protein human Homo sapiens Human MKAAVLTLAVLFLTGSQARHFWQQDEPPQSPWDRVKDLATVYVDVLKDSGRDYVSQFEGSALGKQLNLKLLDNWDSVTSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ apoa1-apoa1 1290480 apoa1_human apoA-I 1290483 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false apoa1_human apoA-I 1290483 ms participant Identification by mass spectrometry ms participant unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f1 homomint mint apoa1-apoa1-1 1290480 apoa1_human apoA-I 1290483 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false apoa1_human apoA-I 1290483 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f2b homomint mint apoa1-apoa1-2 1290480 apoa1_human apoA-I 1290483 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false apoa1_human apoA-I 1290483 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false sf4 homomint mint apoa1-apoa1-3 1290481 apoa1_human apoA-I 1290483 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false apoa1_human apoA-I 1290483 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f2a homomint mint apoa1-apoa1-4 1290481 apoa1_human apoA-I 1290483 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false apoa1_human apoA-I 1290483 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false sf2 homomint mint apoa1-apoa1-5 1290482 apoa1_human apoA-I 1290483 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false apoa1_human apoA-I 1290483 peptide synthesis peptide synthesis unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f2c homomint mint