IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ sawarkar-2012-1 Hsp90 globally targets paused RNA polymerase to regulate gene expression in response to environmental stimuli. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. ch-ip chromatin immunoprecipitation assay ch-ip nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Sawarkar R., Sievers C., Paro R. renato.paro@bsse.ethz.ch Cell (0092-8674) 2012 Only protein-protein interactions imex curation sawarkar-2012-4 Hsp90 globally targets paused RNA polymerase to regulate gene expression in response to environmental stimuli. mouse-raw264_7 Mus musculus monocyte macrophage cell line RAW264 raw264_7 Mouse monocyte macrophage cellline RAW264.7 anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sawarkar R., Sievers C., Paro R. renato.paro@bsse.ethz.ch Cell (0092-8674) 2012 Only protein-protein interactions imex curation sawarkar-2012-2 Hsp90 globally targets paused RNA polymerase to regulate gene expression in response to environmental stimuli. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti bait coip anti bait coimmunoprecipitation anti bait coip anti tag western anti tag western blot anti tag western Sawarkar R., Sievers C., Paro R. renato.paro@bsse.ethz.ch Cell (0092-8674) 2012 Only protein-protein interactions imex curation sawarkar-2012-3 Hsp90 globally targets paused RNA polymerase to regulate gene expression in response to environmental stimuli. drome-schneider_2 Drosophila melanogaster late embryo cells Fruit fly schneider_2 Established from the late embryo of Drosophila melanogaster Mixture of diploid and tetraploid. Originally had some XY cells now predominantly XX. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Sawarkar R., Sievers C., Paro R. renato.paro@bsse.ethz.ch Cell (0092-8674) 2012 Only protein-protein interactions imex curation sawarkar-2012-5 Hsp90 globally targets paused RNA polymerase to regulate gene expression in response to environmental stimuli. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Sawarkar R., Sievers C., Paro R. renato.paro@bsse.ethz.ch Cell (0092-8674) 2012 Only protein-protein interactions imex curation myc_drome_gene Myc gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly hsp83_drome Heat shock protein 83 Hsp83 Hsp82 HSP 82 Hsp90 CG1242 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MPEEAETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELYIKLIPNKTAGTLTIIDTGIGMTKSDLVNNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVADKVTVTSKNNDDEQYVWESSAGGSFTVRADNSEPLGRGTKIVLYIKEDQTDYLEESKIKEIVNKHSQFIGYPIKLLVEKEREKEVSDDEADDEKKEGDEKKEMETDEPKIEDVGEDEDADKKDKDAKKKKTIKEKYTEDEELNKTKPIWTRNPDDISQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRTPFDLFENQKKRNNIKLYVRRVFIMDNCEDLIPEYLNFMKGVVDSEDLPLNISREMLQQNKVLKVIRKNLVKKTMELIEELTEDKENYKKFYDQFSKNLKLGVHEDSNNRAKLADFLRFHTSASGDDFCSLADYVSRMKDNQKHVYFITGESKDQVSNSAFVERVKARGFEVVYMTEPIDEYVIQHLKEYKGKQLVSVTKEGLELPEDESEKKKREEDKAKFESLCKLMKSILDNKVEKVVVSNRLVDSPCCIVTSQFGWSANMERIMKAQALRDTATMGYMAGKKQLEINPDHPIVETLRQKADADKNDKAVKDLVILLFETSLLSSGFSLDSPQVHASRIYRMIKLGLGIDEDEPMTTDDAQSAGDAPSLVEDTEDASHMEEVD traf4_drome_gene TRAF4 gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly ban_drome_gene bantam miRNA gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly hsp26_drome_gene HSP26 gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly hsp72_drome_gene Heat shock protein Hsp70Ba gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly hsp83_drome_gene Heat shock protein 83 gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly cecc_drome_gene Cecropin-C gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly ceca1_drome_gene Cecropin-A1 gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly rhom_drome_gene Rhomboid gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly wun2_drome_gene Wunen2 gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly p53_drome_gene p53 gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly tin_drome_gene Muscle-specific homeobox protein tinman gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly lbde_drome_gene Ladybird early gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly soxn_drome_gene SoxNeuro gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly hmsh_drome_gene Muscle segmentation homeobox gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly notch_drome_gene Neurogenic locus Notch gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly sryd_drome_gene Serendipity locus protein delta gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly serr_drome_gene Protein serrate gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly vein_drome_gene Protein vein gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly spitz_drome_gene Protein spitz gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly grk_drome_gene Protein gurken gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly gil_drome_gene Protein giant-lens gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly spy_drome_gene Protein sprouty gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly sog_drome_gene Dorsal-ventral patterning protein Sog gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly brk_drome_gene Brinker gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly puc_drome_gene Puckered gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly wntg_drome_gene Protein wingless gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly erbb2_human_gene-1 ERBB2_human_gene gene gene human Homo sapiens Human abda_drome_gene Homeobox protein abdominal-A gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly antp_drome_gene Homeotic protein antennapedia gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly hr3_drome_gene Probable nuclear hormone receptor HR3 gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly brc_drome_gene Broad-complex core gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly eip63e_drome_gene Ecdysone-induced protein 63E gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly hid_drome_gene Cell death protein W gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly cg12171_drome_gene CG12171 gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly hsp68_drome_gene Heat shock protein Hsp68 gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly hsp22_drome_gene Heat shock protein Hsp22 gene gene gene drome Drosophila melanogaster (Fruit fly) Fruit fly hs90b_mouse Heat shock protein HSP 90-beta Heat shock 84 kDa Tumor-specific transplantation 84 kDa antigen Hsp90ab1 Hsp84 Hsp84-1 Hspcb protein protein mouse Mus musculus Mouse MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEEDKEDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVTAEEPSAAVPDEIPPLEGDEDASRMEEVD nelfe_mouse Negative elongation factor E Nelfe D17h6s45 RNA-binding protein RD Rd Rdbp protein protein mouse Mus musculus Mouse MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSGPASQGGVKRSLSEQPVVDTATATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSMSADEDLQEPSRRPQRKSLYESFVSSSDRLRELGQDGEEAEAPGAGDGPPRGFDWSYEEHGSARSSASPPRSRSRDRSHDRSRDRDRDKERDRDRDRDRDRDRDKDKDRDRDRDRDKERDRDRDRDRDRERDREGPFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAVQNSPKGCHRDKRTQIVYSDDL nelfe_drome Negative elongation factor E Nelf-E anon-66Da CG5994 protein protein drome Drosophila melanogaster (Fruit fly) Fruit fly MVYIHFPNNLTEEEQMLQAKYQKLKKKKKALQAHKAPKPEPESSLTLKRPTDARDAREVARKLIKSGAIPAIQKQTKQDQTSFKRPKGQERAKRSTSETTVASYQPFSSTQNDVAQETIISEIIKEEPRRQNLYQHFATERDREERGMPEKVPMDTAQPEKPRAGNTIFVSGNKVTEDFLKKTFNDYGTIVNVSMEIEKSRGFVSFAKPESADRAIAEIHGKNVNGINLQVQLARRQPQIEPINDASSSAVWSSIAASKSQKGSHKDHREMVQYDEDFLL hs90b_human Heat shock protein HSP 90-beta HSP90AB1 HSP90B HSPC2 HSPCB Heat shock 84 kDa protein protein human Homo sapiens Human MPEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNKEIFLRELISNASDALDKIRYESLTDPSKLDSGKELKIDIIPNPQERTLTLVDTGIGMTKADLINNLGTIAKSGTKAFMEALQAGADISMIGQFGVGFYSAYLVAEKVVVITKHNDDEQYAWESSAGGSFTVRADHGEPIGRGTKVILHLKEDQTEYLEERRVKEVVKKHSQFIGYPITLYLEKEREKEISDDEAEEEKGEKEEEDKDDEEKPKIEDVGSDEEDDSGKDKKKKTKKIKEKYIDQEELNKTKPIWTRNPDDITQEEYGEFYKSLTNDWEDHLAVKHFSVEGQLEFRALLFIPRRAPFDLFENKKKKNNIKLYVRRVFIMDSCDELIPEYLNFIRGVVDSEDLPLNISREMLQQSKILKVIRKNIVKKCLELFSELAEDKENYKKFYEAFSKNLKLGIHEDSTNRRRLSELLRYHTSQSGDEMTSLSEYVSRMKETQKSIYYITGESKEQVANSAFVERVRKRGFEVVYMTEPIDEYCVQQLKEFDGKSLVSVTKEGLELPEDEEEKKKMEESKAKFENLCKLMKEILDKKVEKVTISNRLVSSPCCIVTSTYGWTANMERIMKAQALRDNSTMGYMMAKKHLEINPDHPIVETLRQKAEADKNDKAVKDLVVLLFETALLSSGFSLEDPQTHSNRIYRMIKLGLGIDEDEVAAEEPNAAVPDEIPPLEGDEDASRMEEVD nelfe_human Negative elongation factor E NELFE RD RDBP RNA-binding protein RD protein protein human Homo sapiens Human MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVKSGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSISADDDLQESSRRPQRKSLYESFVSSSDRLRELGPDGEEAEGPGAGDGPPRSFDWGYEERSGAHSSASPPRSRSRDRSHERNRDRDRDRERDRDRDRDRDRERDRDRDRDRDRDRERDRDRERDRDRDREGPFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAFSPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAVQNSPKGCHRDKRTQIVYSDDVYKENLVDGF hsp83-myc 1295370 n/a 1295375 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Fig. 2A, Table 1 hsp83-traf4 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295377 unspecified role unspecified role prey prey association association false false false Supp. Fig. 2A, Table 1 hsp83-ban 1295370 n/a 1295378 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Fig. 2B, Supp. Fig. 2A hsp83-hsp26 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295379 unspecified role unspecified role prey prey association association false false false Supp. Fig. 2C hsp83-hsp72 1295370 n/a 1295380 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Supp. Fig. 2D, Table 1 hsp83-hsp83 1295370 n/a 1295381 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Fig. 2C hsp83-cecc 1295370 n/a 1295382 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Supp Fig. 6D, Table 1 Radicicol (CHEBI:556075) Lipopolysaccharide hsp83-ceca1 1295370 n/a 1295383 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Supp Fig. 6C, Table 1 Lipopolysaccharide Radicicol (CHEBI:556075) hsp83-rhom 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295384 unspecified role unspecified role prey prey association association false false false Supp. Fig. 6A, Table 1 hsp83-wun2 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295385 unspecified role unspecified role prey prey association association false false false Supp. Fig. 6B hsp83-p53 1295370 n/a 1295386 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Table 1 hsp83-tin 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295387 unspecified role unspecified role prey prey association association false false false Table 1 hsp83-lbde 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295388 unspecified role unspecified role prey prey association association false false false Table 1 hsp83-soxn 1295370 n/a 1295389 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Table 1 hsp83-hmsh 1295370 n/a 1295390 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Table 1 hsp83-notch 1295370 n/a 1295391 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Table 1 hsp83-sryd 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295392 unspecified role unspecified role prey prey association association false false false Table 1 hsp83-serr 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295393 unspecified role unspecified role prey prey association association false false false Table 1 hsp83-vein 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295394 unspecified role unspecified role prey prey association association false false false Table 1 hsp83-spitz 1295370 n/a 1295395 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Table 1 hsp83-grk 1295370 n/a 1295396 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Table 1 hsp83-gil 1295370 n/a 1295397 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Table 1 hsp83-spy 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295398 unspecified role unspecified role prey prey association association false false false Table 1 hsp83-sog 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295399 unspecified role unspecified role prey prey association association false false false Table 1 hsp83-brk 1295370 n/a 1295400 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Table 1 hsp83-puc 1295370 n/a 1295401 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Table 1 hsp83-wntg 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295402 unspecified role unspecified role prey prey association association false false false Table 1 hsp83-scr 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295403 unspecified role unspecified role prey prey association association false false false Table 1 hsp83-abda 1295370 n/a 1295404 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Table 1 hsp83-antp 1295370 n/a 1295405 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Table 1 hsp83-hr3 1295370 n/a 1295406 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Table 1 hsp83-brc 1295370 n/a 1295407 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Table 1 hsp83-eip63e 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295408 unspecified role unspecified role prey prey association association false false false Table 1 hsp83-hid 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295409 unspecified role unspecified role prey prey association association false false false Table 1 hsp83-cg12171 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295410 unspecified role unspecified role prey prey association association false false false Table 1 hsp83-hsp68 1295370 n/a 1295376 unspecified role unspecified role bait bait n/a 1295411 unspecified role unspecified role prey prey association association false false false Table 1 hsp83-hsp22 1295370 n/a 1295412 unspecified role unspecified role prey prey n/a 1295376 unspecified role unspecified role bait bait association association false false false Table 1 rdbp-hsp90ab1 1295371 n/a 1295413 unspecified role unspecified role prey prey n/a 1295414 unspecified role unspecified role bait bait physical association physical association false false false Supp. Fig. 5D hsp90ab1-rdbp 1295371 n/a 1295413 unspecified role unspecified role bait bait n/a 1295414 unspecified role unspecified role prey prey physical association physical association false false false Supp. Fig. 5D hsp83-nelf_e-2 1295372 n/a 1295376 unspecified role unspecified role bait bait n/a 1295415 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5A nelf_e-hsp83 1295373 n/a 1295376 unspecified role unspecified role prey prey n/a 1295415 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 5A hsp90ab1-rdbp-1 1295374 n/a 1295416 unspecified role unspecified role bait bait n/a 1295417 unspecified role unspecified role prey prey physical association physical association false false false Fig. 5G