IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ dadi-2012-9 TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation dadi-2012-1 TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation dadi-2012-2 TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. human-hela Homo sapiens epitheloid cervix carcinoma cells Human hela Human epitheloid cervix carcinoma HeLa cells derivation: cervix; epithelial; adenocarcinoma ATCC no:CCL-2 pull down pull down anti tag western anti tag western blot anti tag western Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation dadi-2012-10 TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. human-all-sil Human ALL-SIL -a T-ALL (T cell acute lymphoblastic leukemia) cell line all-sil ALL-SIL -Human T-ALL (T cell acute lymphoblastic leukemia) cell line carries NUP214-ABL1 fusion gene ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation dadi-2012-11 TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. human-dnd-41 Human DND-41 (T-ALL; type III cortical) cell line dnd-41 Human DND-41 (T-ALL; type III cortical) cell line ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation dadi-2012-3 TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. human-all-sil Human ALL-SIL -a T-ALL (T cell acute lymphoblastic leukemia) cell line all-sil ALL-SIL -Human T-ALL (T cell acute lymphoblastic leukemia) cell line carries NUP214-ABL1 fusion gene anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation dadi-2012-4 TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. human-dnd-41 Human DND-41 (T-ALL; type III cortical) cell line dnd-41 Human DND-41 (T-ALL; type III cortical) cell line anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation dadi-2012-5 TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. human-all-sil Human ALL-SIL -a T-ALL (T cell acute lymphoblastic leukemia) cell line all-sil ALL-SIL -Human T-ALL (T cell acute lymphoblastic leukemia) cell line carries NUP214-ABL1 fusion gene confocal microscopy confocal microscopy immunostaining immunostaining Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation dadi-2012-6 TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. human-t-all Human-T-cell acute lymphoblastic leukemia cells t-cell_acute_lymphoblastic_leukemia T-cell acute lymphoblastic leukemia cell (T-ALL) confocal microscopy confocal microscopy immunostaining immunostaining Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation dadi-2012-7 TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. human-dnd-41 Human DND-41 (T-ALL; type III cortical) cell line dnd-41 Human DND-41 (T-ALL; type III cortical) cell line confocal microscopy confocal microscopy immunostaining immunostaining Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation dadi-2012-8 TLX Homeodomain Oncogenes Mediate T Cell Maturation Arrest in T-ALL via Interaction with ETS1 and Suppression of TCRα Gene Expression. human-t-all Human-T-cell acute lymphoblastic leukemia cells t-cell_acute_lymphoblastic_leukemia T-cell acute lymphoblastic leukemia cell (T-ALL) confocal microscopy confocal microscopy immunostaining immunostaining Dadi S., Le Noir S., Payet-Bornet D., Lhermitte L., Zacarias-Cabeza J., Bergeron J., Villarese P., Vachez E., Dik W.A., Millien C., Radford I., Verhoeyen E., Cosset F.L., Petit A., Ifrah N., Dombret H., Hermine O., Spicuglia S., Langerak A.W., Macintyre E.A., Nadel B., Ferrier P., Asnafi V. Cancer - Interactions investigated in the context of cancer TLX1 and TLX3 cDNAs were prepared using mRNA extracted from the ALL-SIL and DND41 cell lines, respectively. The species of ETS1 constructs/proteins was provided by the authors. ferrier@ciml.univ-mrs.fr, vahid.asnafi@nck.aphp.fr Cancer Cell (1535-6108) 2012 Only protein-protein interactions imex curation tca-alpha_enhancer_ebs E-alpha core element containing ETS1 and RUNX1 binding sites dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human TCTCCCGCAGAAGCCACATCCTCTGGAAAGA ets1a_chick Transforming protein p54/c-ets-1 ETS1 protein protein chick Gallus gallus (Chicken) Chicken MKAAVDLKPTLTIIKTEKVDIDLFPSPDMECADVPLLTPSSKEMMSQALKATFSGFAKEQQRLGIPKDPQQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKECFLELRPDFVGDILWEHLEILQKEEAKPYPANGVNAAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPVQTDSLQTDYFTIKQEVVTPDNMCMGRASRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFQSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADMNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE tlx1_human T-cell leukemia homeobox protein 1 TLX1 HOX11 TCL3 Homeobox protein Hox-11 Proto-oncogene TCL-3 T-cell leukemia/lymphoma protein 3 protein protein human Homo sapiens Human MEHLGPHHLHPGHAEPISFGIDQILNSPDQGGCMGPASRLQDGEYGLGCLVGGAYTYGGGGSAAATGAGGAGAYGTGGPGGPGGPAGGGGACSMGPLTGSYNVNMALAGGPGPGGGGGSSGGAGALSAAGVIRVPAHRPLAGAVAHPQPLATGLPTVPSVPAMPGVNNLTGLTFPWMESNRRYTKDRFTGHPYQNRTPPKKKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQANRILLQLQQEAFQKSLAQPLPADPLCVHNSSLFALQNLQPWSDDSTKITSVTSVASACE tlx2_human T-cell leukemia homeobox protein 2 TLX2 HOX11L1 NCX Homeobox protein Hox-11L1 Neural crest homeobox protein protein protein human Homo sapiens Human MEPGMLGPHNLPHHEPISFGIDQILSGPETPGGGLGLGRGGQGHGENGAFSGGYHGASGYGPAGSLAPLPGSSGVGPGGVIRVPAHRPLPVPPPAGGAPAVPGPSGLGGAGGLAGLTFPWMDSGRRFAKDRLTAALSPFSGTRRIGHPYQNRTPPKRKKPRTSFSRSQVLELERRFLRQKYLASAERAALAKALRMTDAQVKTWFQNRRTKWRRQTAEEREAERHRAGRLLLHLQQDALPRPLRPPLPPDPLCLHNSSLFALQNLQPWAEDNKVASVSGLASVV ets1_mouse Protein C-ets-1 Ets1 Ets-1 p54 protein protein mouse Mus musculus Mouse MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMSGAALCALGKECFLELAPDFVGDILWEHLEILQKEDVKPYQVNGANPTYPESCYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILQDPLQTDTLQTDYFAIKQEVLTPDNMCLGRASRGKLGGQDSFESVESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDYEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDAD tlx3_human T-cell leukemia homeobox protein 3 TLX3 HOX11L2 Homeobox protein Hox-11L2 protein protein human Homo sapiens Human MEAPASAQTPHPHEPISFGIDQILNSPDQDSAPAPRGPDGASYLGGPPGGRPGATYPSLPASFAGLGAPFEDAGSYSVNLSLAPAGVIRVPAHRPLPGAVPPPLPSALPAMPSVPTVSSLGGLNFPWMESSRRFVKDRFTAAAALTPFTVTRRIGHPYQNRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQASRLMLQLQHDAFQKSLNDSIQPDPLCLHNSSLFALQNLQPWEEDSSKVPAVTSLV ets1_human Protein C-ets-1 p54 ETS1 EWSR2 protein protein human Homo sapiens Human MKAAVDLKPTLTIIKTEKVDLELFPSPDMECADVPLLTPSSKEMMSQALKATFSGFTKEQQRLGIPKDPRQWTETHVRDWVMWAVNEFSLKGVDFQKFCMNGAALCALGKDCFLELAPDFVGDILWEHLEILQKEDVKPYQVNGVNPAYPESRYTSDYFISYGIEHAQCVPPSEFSEPSFITESYQTLHPISSEELLSLKYENDYPSVILRDPLQTDTLQNDYFAIKQEVVTPDNMCMGRTSRGKLGGQDSFESIESYDSCDRLTQSWSSQSSFNSLQRVPSYDSFDSEDYPAALPNHKPKGTFKDYVRDRADLNKDKPVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVKPDADE tcr-alpha_enhancer T Cell Receptor-Alpha_Enhancer dna deoxyribonucleic acid DNA deoxyribonucleic acid dna DNA deoxyribonucleic acid human Homo sapiens Human GGCGGTCCCCTCCCATTTCCATGACGTCATGGTTACCAAGAGGGGCAAGTAGGGCACCCTTTGAAGCTCTCCCGCAGAAGCCACATCCTCTGGAAAGA Sequence given is from the Human TCR-alpha minimal enhancer - Giese at al, Genes and Development. 1995. tca_alpha-ets1 1286846 n/a 1286857 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1286858 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Fig 5A/B The addition of TLX1 (lanes 2–4) or TLX3 (lanes 5–7) to ETS1 and EBS produced a dose-dependent "super-shifted" complex. tca_alpha-ets1-2 1286846 n/a 1286857 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1286858 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1286859 unspecified role unspecified role ancillary ancillary physical association physical association false false false Fig 5A/B The addition of TLX1 (lanes 2–4) or TLX3 (lanes 5–7) to ETS1 and EBS produced a dose-dependent "super-shifted" complex. tca_alpha-ets1-3 1286846 n/a 1286860 unspecified role unspecified role ancillary ancillary n/a 1286858 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1286857 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 5A/B The addition of TLX1 (lanes 2–4) or TLX3 (lanes 5–7) to ETS1 and EBS produced a dose-dependent "super-shifted" complex. tlx1-ets1 1286847 n/a 1286861 unspecified role unspecified role prey prey ets_dna_binding_domain required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1286859 unspecified role unspecified role bait bait homeodomain required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecoli Escherichia coli (strain K12) 1286887 1286884 direct interaction direct interaction false false false Fig 3A tlx3-ets1 1286847 n/a 1286861 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ets_dna_binding_domain required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false in vitro In vitro n/a 1286862 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false homeodomain required to bind necessary binding region required to bind deletion analysis deletion analysis range range range range false ecoli Escherichia coli (strain K12) 1286895 1286892 direct interaction direct interaction false false false Fig 3A tlx1-ets1-1 1286848 n/a 1286861 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1286859 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sbp sbp undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 3B tlx3-ets1-2 1286848 n/a 1286861 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1286862 unspecified role unspecified role bait bait region sbp sbp undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig 3B ets1-tcr_alpha 1286849 n/a 1286863 unspecified role unspecified role bait bait n/a 1286864 unspecified role unspecified role prey prey association association false false false Fig 5 C/D Knockdown of ETS1 reduced Eα-binding by both ETS1 and TLX1/TLX3. tx1-tcr_alpha 1286849 n/a 1286864 unspecified role unspecified role prey prey n/a 1286859 unspecified role unspecified role bait bait association association false false false Fig 5 C/D Knockdown of ETS1 reduced Eα-binding by both ETS1 and TLX1/TLX3. tlx3-tcr_alpha-1 1286850 n/a 1286864 unspecified role unspecified role prey prey n/a 1286862 unspecified role unspecified role bait bait association association false false false Fig 5 C/D Knockdown of ETS1 reduced Eα-binding by both ETS1 and TLX1/TLX3. ets1-tcr_alpha 1286850 n/a 1286863 unspecified role unspecified role bait bait n/a 1286864 unspecified role unspecified role prey prey association association false false false Fig 5 C/D Knockdown of ETS1 reduced Eα-binding by both ETS1 and TLX1/TLX3. tlx1-ets1-2 1286851 n/a 1286863 unspecified role unspecified role prey prey n/a 1286859 unspecified role unspecified role bait bait physical association physical association false false false Fig 3C tlx3-ets1-4 1286852 n/a 1286863 unspecified role unspecified role prey prey n/a 1286862 unspecified role unspecified role bait bait physical association physical association false false false Fig 3C ets1-tlx1 1286853 n/a 1286859 unspecified role unspecified role neutral component neutral component n/a 1286863 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 4C/D ets1-tlx1-1 1286854 n/a 1286859 unspecified role unspecified role neutral component neutral component n/a 1286863 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 4C ets1-tlx3 1286855 n/a 1286862 unspecified role unspecified role neutral component neutral component n/a 1286863 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 4C ets1-tlx3-1 1286856 n/a 1286863 unspecified role unspecified role neutral component neutral component n/a 1286862 unspecified role unspecified role neutral component neutral component colocalization colocalization false false false Fig 4C