mpidb The Microbial Protein Interaction Database durand_heredia-2012-1 Identification of ZapD as a cell division factor that promotes the assembly of FtsZ in Escherichia coli. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast fluorescence fluorescence technology fluorescence tag fluorescence tag visualisation by fluorescence tag fluorescence Durand-Heredia J., Rivkin E., Fan G., Morales J., Janakiraman A. The assay relies on the reoviral scaffolding protein mu-NS, which forms large focal inclusions in yeast. When a query protein is fused to mu-NS and a likely interaction partner fused to a fluorophore, interactions can be identified by screening for yeast that form fluorescent foci. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation durand_heredia-2012-2 Identification of ZapD as a cell division factor that promotes the assembly of FtsZ in Escherichia coli. in vitro In vitro gtpase assay gtpase assay GTPase gtp hydrolisis gtp hydrolisis GTPase predetermined predetermined participant predetermined Durand-Heredia J., Rivkin E., Fan G., Morales J., Janakiraman A. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation durand_heredia-2012-3 Identification of ZapD as a cell division factor that promotes the assembly of FtsZ in Escherichia coli. ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Durand-Heredia J., Rivkin E., Fan G., Morales J., Janakiraman A. The assay relies on the reoviral scaffolding protein mu-NS, which forms large focal inclusions in yeast. When a query protein is fused to mu-NS and a likely interaction partner fused to a fluorophore, interactions can be identified by screening for yeast that form fluorescent foci. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation zapd_ecoli Cell division protein ZapD zapD Z ring-associated protein D yacF JW0099 b0102 protein protein ecoli Escherichia coli (strain K12) MQTQVLFEHPLNEKMRTWLRIEFLIQQLTVNLPIVDHAGALHFFRNVSELLDVFERGEVRTELLKELDRQQRKLQTWIGVPGVDQSRIEALIQQLKAAGSVLISAPRIGQFLREDRLIALVRQRLSIPGGCCSFDLPTLHIWLHLPQAQRDSQVETWIASLNPLTQALTMVLDLIRQSAPFRKQTSLNGFYQDNGGDADLLRLNLSLDSQLYPQISGHKSRFAIRFMPLDTENGQVPERLDFELACC ftsz_ecoli Cell division protein FtsZ ftsZ sfiB sulB b0095 JW0093 protein protein ecoli Escherichia coli (strain K12) MFEPMELTNDAVIKVIGVGGGGGNAVEHMVRERIEGVEFFAVNTDAQALRKTAVGQTIQIGSGITKGLGAGANPEVGRNAADEDRDALRAALEGADMVFIAAGMGGGTGTGAAPVVAEVAKDLGILTVAVVTKPFNFEGKKRMAFAEQGITELSKHVDSLITIPNDKLLKVLGRGISLLDAFGAANDVLKGAVQGIAELITRPGLMNVDFADVRTVMSEMGYAMMGSGVASGEDRAEEAAEMAISSPLLEDIDLSGARGVLVNITAGFDLRLDEFETVGNTIRAFASDNATVVIGTSLDPDMNDELRVTVVATGIGMDKRPEITLVTNKQVQQPVMDRYQQHGMAPLTQEQKPVAKVVNDNAPQTAKEPDYLDIPAFLRKQAD gtp guanosine triphosphate - GTP 5'-GTP GTP Guanosine 5'-triphosphate guanosine 5'-triphosphoric acid guanosine triphosphate GUANOSINE-5'-TRIPHOSPHATE H4gtp guanosine 5'-(tetrahydrogen triphosphate) small molecule small molecule chemical synthesis Chemical synthesis (Chemical synthesis) InChI=1/C10H16N5O14P3/c11-10-13-7-4(8(18)14-10)12-2-15(7)9-6(17)5(16)3(27-9)1-26-31(22,23)29-32(24,25)28-30(19,20)21/h2-3,5-6,9,16-17H,1H2,(H,22,23)(H,24,25)(H2,19,20,21)(H3,11,13,14,18)/t3-,5-,6-,9-/m1/s1/f/h14,19-20,22,24H,11H2 zapd-zapd 1339689 not-defined-1424359302 1339692 unspecified role unspecified role prey prey region P36680-- gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-531601721 1339692 unspecified role unspecified role bait bait mu-ns fusion P36680-- fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 2 zapd-ftsz 1339689 not-defined-386259665 1339693 unspecified role unspecified role prey prey region P0A9A6-- gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1947827924 1339692 unspecified role unspecified role bait bait mu-ns fusion P36680-- fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 2 ftsz-zapd 1339689 not-defined-359046129 1339693 unspecified role unspecified role bait bait mu-ns fusion fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false not-defined-1922336750 1339692 unspecified role unspecified role prey prey region gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 2, Table 2 ftsz-gtp-1 1339690 n/a 1339694 enzyme target enzyme target substrate substrate unspecified role unspecified role n/a 1339693 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction false false false Fig. 7 ftsz-gtp-3 1339690 n/a 1339692 inhibitor inhibitor unspecified role unspecified role ecoli Escherichia coli (strain K12) n/a 1339694 enzyme target enzyme target substrate substrate unspecified role unspecified role n/a 1339693 enzyme enzyme unspecified role unspecified role ecoli Escherichia coli (strain K12) gtpase reaction gtpase reaction false false false Fig. 7 zapd-zapd-1 1339691 not-defined-484602162 1339692 unspecified role unspecified role unspecified role unspecified role Stoichiometry: 2.0 physical association physical association false false false supplemental figure 3B