mpidb The Microbial Protein Interaction Database ollis-2012-1 Identification of functionally important TonB-ExbD periplasmic domain interactions in vivo. ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Ollis A.A., Postle K. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation exbd_ecoli Biopolymer transport protein ExbD exbD JW2973 b3005 protein protein ecoli Escherichia coli (strain K12) MAMHLNENLDDNGEMHDINVTPFIDVMLVLLIIFMVAAPLATVDVKVNLPASTSTPQPRPEKPVYLSVKADNSMFIGNDPVTDETMITALNALTEGKKDTTIFFRADKTVDYETLMKVMDTLHQAGYLKIGLVGEETAKAK tonb_ecoli Protein TonB tonB exbA JW5195 b1252 protein protein ecoli Escherichia coli (strain K12) MTLDLPRRFPWPTLLSVCIHGAVVAGLLYTSVHQVIELPAPAQPISVTMVTPADLEPPQAVQPPPEPVVEPEPEPEPIPEPPKEAPVVIEKPKPKPKPKPKPVKKVQEQPKRDVKPVESRPASPFENTAPARLTSSTATAATSKPVTSVASGPRALSRNQPQYPARAQALRIEGQVKVKFDVTPDGRVDNVQILSAKPANMFEREVKNAMRRWRYEPGKPGSGIVVNILFKINGTTEIQ exbd-p02929-1 1339654 not-defined-1793986964 1339655 unspecified role unspecified role suppressor suppressor gene suppressor P0ABV2:p.Thr109Cys P0ABV2-109-109 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Lys97Cys P0ABV2-97-97 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Asp25Asn P0ABV2-25-25 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P0ABV2:p.Ala92Cys P0ABV2-92-92 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false not-defined-1026435351 1339656 unspecified role unspecified role unspecified role unspecified role P02929:p.Arg212Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P02929:p.Arg204Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P02929:p.Ala150Cys P02929-168-168 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P02929:p.Gly152Cys P02929-170-170 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P02929:p.Arg166Cys P02929-200-200 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P02929:p.Gln168Cys P02929-202-202 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P02929:p.Leu170Cys P02929-214-214 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P02929:p.Pro164Cys P02929-166-166 mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P02929:p.Asn200Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false P02929:p.Phe202Cys mutation increasing mutation increasing interaction mutation increasing certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 2-6