UniProt UniProt http://www.uniprot.org shi-2012a-2 Sin3 interacts with Foxk1 and regulates myogenic progenitors. ecobb Escherichia coli (strain B / BL21) pull down pull down western blot western blot Immuno blot Immuno blot Shi X., Garry D.J. garry@umn.edu Mol. Cell. Biochem. (0300-8177) 2012 Only protein-protein interactions imex curation shi-2012a-1 Sin3 interacts with Foxk1 and regulates myogenic progenitors. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Shi X., Garry D.J. garry@umn.edu Mol. Cell. Biochem. (0300-8177) 2012 Only protein-protein interactions imex curation foxk1_mouse Forkhead box protein K1 Myocyte nuclear factor Foxk1 Mnf protein protein mouse Mus musculus Mouse MAEVGEDSGARALLALRSAPCSPVLCAAAAAAAFPATTSPPPPAQPPPGPPALPAEPGPGPVPSTVATATTTAPALVAAAAASVRQSPGPALARLEGREFEFLMRQPSVTIGRNSSQGSVDLSMGLSSFISRRHLQLSFQEPHFYLRCLGKNGVFVDGAFQRRGAPALQLPQQCTFRFPSTAIKIQFTSLYHKEEAPASPLRPLYPQISPLKIHIPEPDLRSLVSPIPSPTGTISVPNSCPASPRGAGSSSYRFVQNVTSDLQLAAEFAAKAASEQQADASGGDSPKDESKPPYSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWRIDPASEAKLVEQAFRKRRQRGVSCFRTPFGPLSSRSAPASPTHPGLMSPRSSGLQTPECLSREGSPIPHDPDLGSKLASVPEYRYSQSAPGSPVSAQPVIMAVPPRPSNLVAKPVAYMPASIVTSQQPSGHAIHVVQQAPTVTMVRVVTTSANSANGYILASQGSTGTSHDTAGTAVLDLGNEARGLEEKPTIAFATIPAASRVIQTVASQMAPGVPGHTVTILQPATPVTIGQHHLPVRAVTQNGKHAVPTNSLTGNAYALSSPLQLLAAQASSSTPVVITRVCEVGPEEPAAAVSVAANAAPTPAASTTTSASSSGEPEVKRSRVEEPGGTATTQPTAMAATGPQGPGTGE q62141-2 Paired amphipathic helix protein Sin3b Sin3b Kiaa0700 Histone deacetylase complex subunit Sin3b Transcriptional corepressor Sin3b protein protein mouse Mus musculus Mouse MAHAGSGGSAGRGFGGSRWGRSGSGGHEKLPVHVEDALTYLDQVKIRFGSDPATYNGFLEIMKEFKSQSIDTPGVIRRVSQLFHEHPDLIVGFNAFLPLGYRIDIPKNGKLNIQSPLSSQDNSHSHGDCGEDFKQMSYKEDRGQVPLESDSVEFNNAISYVNKIKTRFLDHPEIYRSFLEILHTYQKEQLHTKGRPFRGMSEEEVFTEVANLFRGQEDLLSEFGQFLPEAKRSLFTGNGSCEMNSGQKNEEKSLEHNKKRSRPSLLRPVSAPAKVGLQLKCAVVWFGYCTAEE foxk1-sin3b-3 1330257 n/a 1330259 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1330260 unspecified role unspecified role prey prey physical association physical association false false false Figure 2 a, b, c, d sin3b-foxk1 1330257 n/a 1330259 unspecified role unspecified role prey prey region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 1330260 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false 1330270 1330267 physical association physical association false false false Figure 2 a, b, c, d foxk1-sin3b-4 1330258 n/a 1330259 unspecified role unspecified role bait bait region required to bind necessary binding region required to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n/a 1330260 unspecified role unspecified role prey prey region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false 1330275 1330273 physical association physical association false false false Figure 1a, 1b