MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint luo-2012b-2 Formation of amyloid fibrils from β-amylase. in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Luo JC., Wang SC., Jian WB., Chen CH., Tang JL., Lee CI. FEBS Lett. (0014-5793) 2012 Only protein-protein interactions imex curation luo-2012b-1 Formation of amyloid fibrils from β-amylase. in vitro In vitro cd circular dichroism CD CD cd predetermined predetermined participant predetermined Luo JC., Wang SC., Jian WB., Chen CH., Tang JL., Lee CI. FEBS Lett. (0014-5793) 2012 Only protein-protein interactions imex curation luo-2012b-3 Formation of amyloid fibrils from β-amylase. in vitro In vitro tem transmission electron microscopy tem predetermined predetermined participant predetermined Luo JC., Wang SC., Jian WB., Chen CH., Tang JL., Lee CI. FEBS Lett. (0014-5793) 2012 Only protein-protein interactions imex curation prio_mouse Major prion protein PrP27-30 PrP33-35C Prnp Prn-p Prp protein protein mouse Mus musculus Mouse MANLGYWLLALFVTMWTDVGLCKKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGTWGQPHGGGWGQPHGGSWGQPHGGSWGQPHGGGWGQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMIHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRSSSTVLFSSPPVILLISFLIFLIVG amyb_horvu Beta-amylase BMY1 1,4-alpha-D-glucan maltohydrolase AMYB protein protein horvu Hordeum vulgare (Barley) Barley MEVNVKGNYVQVYVMLPLDAVSVNNRFEKGDELRAQLRKLVEAGVDGVMVDVWWGLVEGKGPKAYDWSAYKQLFELVQKAGLKLQAIMSFHQCGGNVGDAVNIPIPQWVRDVGTRDPDIFYTDGHGTRNIEYLTLGVDNQPLFHGRSAVQMYADYMTSFRENMKDFLDAGVIVDIEVGLGPAGEMRYPSYPQSHGWSFPGIGEFICYDKYLQADFKAAAAAVGHPEWEFPNDVGQYNDTPERTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWYKVPSHAAELTAGYYNLHDRDGYRTIARMLKRHRASINFTCAEMRDLEQSSQAMSAPEELVQQVLSAGWREGLNVACENALPRYDPTAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYVNFKTFVDRMHANLPRDPYVDPMAPLPRSGPEISIEMILQAAQPKLQPFPFQEHTDLPVGPTGGMGGQAEGPTCGMGGQVKGPTGGMGGQAEDPTSGIGGELPATM mint prnp-prnp-30 1267540 prio_mouse MoPrP 1267543 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified prp PrP polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false prio_mouse MoPrP 1267543 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified prp PrP polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f2a homomint mint prnp-prnp-31 1267540 prio_mouse MoPrP 1267543 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified prp PrP polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false prio_mouse MoPrP 1267543 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified prp PrP polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3 homomint mint bmy1-bmy1-1 1267540 beta-amylase Beta-Amylase 1267544 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified beta-amylase Beta-Amylase 1267544 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f2 mint bmy1-bmy1-2 1267540 beta-amylase Beta-Amylase 1267544 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified beta-amylase Beta-Amylase 1267544 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified prp PrP polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3 mint prnp-prnp-29 1267541 prio_mouse MoPrP 1267543 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified prp PrP polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false prio_mouse MoPrP 1267543 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified prp PrP polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f1d homomint mint bmy1-bmy1 1267541 beta-amylase Beta-Amylase 1267544 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified beta-amylase Beta-Amylase 1267544 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f1d mint prnp-prnp-32 1267542 prio_mouse MoPrP 1267543 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified prp PrP polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false prio_mouse MoPrP 1267543 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified prp PrP polyprotein frag polyprotein fragment polyprotein frag certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint mint f4A bmy1-bmy1-3 1267542 beta-amylase Beta-Amylase 1267544 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified beta-amylase Beta-Amylase 1267544 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false f4b mint