mpidb The Microbial Protein Interaction Database sal_man-2012-1 EscA is a crucial component of the type III secretion system of enteropathogenic Escherichia coli. ecolx Escherichia coli anti tag coip anti tag coimmunoprecipitation anti tag coip ms participant Identification by mass spectrometry ms participant Sal-Man N., Biemans-Oldehinkel E., Sharon D., Croxen M.A., Scholz R., Foster L.J., Finlay B.B. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation sal_man-2012-2 EscA is a crucial component of the type III secretion system of enteropathogenic Escherichia coli. ecolx Escherichia coli anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Sal-Man N., Biemans-Oldehinkel E., Sharon D., Croxen M.A., Scholz R., Foster L.J., Finlay B.B. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation b7umb3_eco27 Type 3 secretion system secretin escC sctC E2348C_3955 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MKKISFFIFTALFCCSAQAAPSSLEKRLGKNEYFIITKSSPVRAILNDFAANYSIPVFISSSVNDDFSGEIKNEKPVKVLEKLSKLYHLTWYYDENILYIYKTNEISRSIITPTYLDIDSLLKYLSDTISVNKNSCNVRKITTFNSIEVRGVPECIKYITSLSESLDKEAQSKAKNKDVVKVFKLNYASATDITYKYRDQNVVVPGVVSILKTMASNGSLPSTGKGAVERSGNLFDNSVTISADPRLNAVVVKDREITMDIYQQLISELDIEQRQIEISVSIIDVDANDLQQLGVNWSGTLNAGQGTIAFNSSTAQANISSSVISNASNFMIRVNALQQNSKAKILSQPSIITLNNMQAILDKNVTFYTKVSGEKVASLESITSGTLLRVTPRILDDSSNSLTGKRRERVRLLLDIQDGNQSTNQSNAQDASSTLPEVQNSEMTTEATLSAGESLLLGGFIQDKESSSKDGIPLLSDIPVIGSLFSSTVKQKHSVVRLFLIKATPIKSASSE b7uma5_eco27 E2348C_3947 protein protein eco27 Escherichia coli O127:H6 (strain E2348/69 / EPEC) MLDRILSIRKSRANRLRESMAKINSQIKEVDGKLDDCEQSIKESIASKQAYCASLVNLDKVSLYKYQIKNNAFDEQKQRLYEKKSSLSKEKRSLLDSQKRTKENLQHVNKSVEKLSFAIKEHYFD b7uma5-escc 1339640 not-defined-988706778 1339642 unspecified role unspecified role prey prey region identified peptide identified peptide certain certain sequence position certain certain certain sequence position certain false not-defined-773604134 1339643 unspecified role unspecified role bait bait b7uma5-- B7UMA5-- ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 5A b7uma5-escc-2 1339641 not-defined-1239254467 1339642 unspecified role unspecified role prey prey b7umb3-- B7UMB3-- ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1156438219 1339643 unspecified role unspecified role bait bait hsv tag tag tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 5