MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint mishra-2012-1 Cataract-linked γD-crystallin mutants have weak affinity to lens chaperones α-crystallins. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Mishra S., Stein RA., McHaourab HS. FEBS Lett. (0014-5793) 2012 Only protein-protein interactions imex curation mishra-2012-2 Cataract-linked γD-crystallin mutants have weak affinity to lens chaperones α-crystallins. in vitro In vitro fluorescence fluorescence technology fluorescence predetermined predetermined participant predetermined Mishra S., Stein RA., McHaourab HS. FEBS Lett. (0014-5793) 2012 Only protein-protein interactions imex curation crgd_human Gamma-crystallin D Gamma-crystallin 4 CRYGD CRYG4 Gamma-D-crystallin protein protein human Homo sapiens Human MGKITLYEDRGFQGRHYECSSDHPNLQPYLSRCNSARVDSGCWMLYEQPNYSGLQYFLRRGDYADHQQWMGLSDSVRSCRLIPHSGSHRIRLYEREDYRGQMIEFTEDCSCLQDRFRFNEIHSLNVLEGSWVLYELSNYRGRQYLLMPGDYRRYQDWGATNARVGSLRRVIDFS mint homomint cryab_mouse Alpha-crystallin B chain Cryab Crya2 Alpha(B)-crystallin P23 protein protein mouse Mus musculus Mouse MDIAIHHPWIRRPFFPFHSPSRLFDQFFGEHLLESDLFSTATSLSPFYLRPPSFLRAPSWIDTGLSEMRLEKDRFSVNLDVKHFSPEELKVKVLGDVIEVHGKHEERQDEHGFISREFHRKYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVAAAPKK cryaa_rat Alpha-crystallin A chain Cryaa Crya1 protein protein rat Rattus norvegicus (Rat) Rat MDVTIQHPWFKRALGPFYPSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISELMTHMWFVMHQPHAGNPKNNPGKVRSDRDKFVIFLDVKHFSPEDLTVKVLEDFVEIHGKHNERQDDHGYISREFHRRYRLPSNVDQSALSCSLSADGMLTFSGPKVQSGLDAGHSERAIPVSREEKPSSAPSS mint cryab-crygd 1253496 gammad-crystallin gammaD crystallin 1253498 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P07320:p.Ile4Phe mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P07320:p.Val76Asp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false cryab_mouse alphaB Crystallin 1253499 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P23927:p.Ser45Asp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P23927:p.Ser19Asp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P23927:p.Ser59Asp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false homomint mint f5b f5c cryaa-crygd 1253496 alphaa-crystallin alphaA Crystallin 1253500 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified gammad-crystallin gammaD Crystallin 1253498 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P07320:p.Val76Asp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P07320:p.Ile4Phe mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f5a mint cryaa-crygd-1 1253497 gammad-crystallin gammaD Crystallin 1253498 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P07320:p.Val76Asp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P07320:p.Ile4Phe mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false alphaa-crystallin alphaA Crystallin 1253500 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified direct interaction direct interaction false false false 1253497 f4a mint cryab-crygd-1 1253497 gammad-crystallin gammaD crystallin 1253498 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P07320:p.Val76Asp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P07320:p.Ile4Phe mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false cryab_mouse alphaB Crystallin 1253499 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified P23927:p.Ser45Asp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P23927:p.Ser59Asp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false P23927:p.Ser19Asp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false 1253497 f4b homomint mint