mpidb The Microbial Protein Interaction Database diaz-2012-1 Bacillus subtilis RapA phosphatase domain interaction with its substrate, phosphorylated Spo0F, and its inhibitor, the PhrA peptide. in vitro In vitro in gel phosphatase in gel phosphatase assay in gel phosphatase predetermined predetermined participant predetermined Diaz A.R., Core L.J., Jiang M., Morelli M., Chiang C.H., Szurmant H., Perego M. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation diaz-2012-2 Bacillus subtilis RapA phosphatase domain interaction with its substrate, phosphorylated Spo0F, and its inhibitor, the PhrA peptide. ecolx Escherichia coli comig non denat gel comigration in non denaturing gel electrophoresis comig non denat gel weight by staining molecular weight estimation by staining weight by staining Diaz A.R., Core L.J., Jiang M., Morelli M., Chiang C.H., Szurmant H., Perego M. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation sp0f_bacsu Sporulation initiation phosphotransferase F spo0F Stage 0 sporulation protein F BSU37130 protein protein bacsu Bacillus subtilis MMNEKILIVDDQYGIRILLNEVFNKEGYQTFQAANGLQALDIVTKERPDLVLLDMKIPGMDGIEILKRMKVIDENIRVIIMTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKSN 4130377E3558D698 rapa_bacsu Response regulator aspartate phosphatase A rapA Glucose starvation-inducible protein A Stage 0 sporulation protein L gsiAA spo0L BSU12430 protein protein bacsu Bacillus subtilis MRMKQTIPSSYVGLKINEWYTHIRQFHVAEAERVKLEVEREIEDMEEDQDLLLYYSLMEFRHRVMLDYIKPFGEDTSQLEFSELLEDIEGNQYKLTGLLEYYFNFFRGMYEFKQKMFVSAMMYYKRAEKNLALVSDDIEKAEFAFKMAEIFYNLKQTYVSMSYAVQALETYQMYETYTVRRIQCEFVIAGNYDDMQYPERALPHLELALDLAKKEGNPRLISSALYNLGNCYEKMGELQKAAEYFGKSVSICKSEKFDNLPHSIYSLTQVLYKQKNDAEAQKKYREGLEIARQYSDELFVELFQFLHALYGKNIDTESVSHTFQFLEEHMLYPYIEELAHDAAQFYIENGQPEKALSFYEKMVHAQKQIQRGDCLYEI phra_bacsu Phosphatase RapA inhibitor phrA gsiAB BSU12440 Phosphatase regulator A protein protein bacsu Bacillus subtilis MKSKWMSGLLLVAVGFSFTQVMVHAGETANTEGKTFHIAARNQT cmpa_bacsu Transcriptional regulatory protein ComA comA Competence protein A comA1 comAA BSU31680 protein protein bacsu Bacillus subtilis MKKILVIDDHPAVMEGTKTILETDSNLSVDCLSPEPSEQFIKQHDFSSYDLILMDLNLGGEVNGMELSKQILQENPHCKIIVYTGYEVEDYFEEAIRAGLHGAISKTESKEKITQYIYHVLNGEILVDFAYFKQLMTQQKTKPAPSSQKEQDVLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKSDGVL 52D01A9740759072 rapa-spo0f 1339530 not-defined-1478944139 1339532 enzyme target enzyme target substrate substrate unspecified role unspecified role region nphosres N-phosphorylated residue NPhosRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-463808467 1339533 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli dephosphorylation dephosphorylation reaction dephosphorylation false false false figure 1and 5 phra-rapa-1 1339530 not-defined-463808467 1339533 enzyme enzyme unspecified role unspecified role ecolx Escherichia coli not-defined-1478944139 1339532 enzyme target enzyme target substrate substrate unspecified role unspecified role region nphosres N-phosphorylated residue NPhosRes undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli n/a 1339534 inhibitor inhibitor unspecified role unspecified role region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false dephosphorylation dephosphorylation reaction dephosphorylation false false false figure 1 RapAY224A, RapAN225A, RapAN228A, and RapAH260A proteins dephosphorylated Spo0F∼P at the same rate as the wild-type protein, but none of them was inhibited by the PhrA pentapeptide coma-rapa-2 1339531 not-defined-1323714648 1339533 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli not-defined-887860374 1339535 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association false false false figure 4