mpidb The Microbial Protein Interaction Database hung-2012-1 Oligomerization of the response regulator ComE from Streptococcus mutans is affected by phosphorylation. ecolx Escherichia coli crosslink cross-linking study crosslink weight by staining molecular weight estimation by staining weight by staining Hung D.C., Downey J.S., Kreth J., Qi F., Shi W., Cvitkovitch D.G., Goodman S.D. Cross-linking reagent, DMS. proteisn stained with Ni-NTA-Atto conjugate staining, specific for His-tagged proteins. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation q8ds93_strmu comE SMU_1917 protein protein strain atcc 700610 / Streptococcus mutans serotype c MISIFVLEDDFLQQGRLETTIAAIMKEKNWSYKELTIFGKPQQLIDAIPEKGNHQIFFLDIEIKKEEKKGLEVANQIRQHNPSAVIVFVTTHSEFMPLTFQYQVSALDFIDKSLNPEEFSHRIESALYYAMENSQKNGQSEELFIFHSSETQFQVPFAEILYFETSSTAHKLCLYTYDERIEFYGSMTDIVKMDKRLFQCHRSFIVNPANITRIDRKKRLAYFRNNKSCLISRTKLTKLRAVIADQRRAK come-come 1339498 not-defined-708055714 1339499 unspecified role unspecified role unspecified role unspecified role Q8DS93:p.Asp60Glu mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false Q8DS93:p.Asp60Ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 6