mpidb The Microbial Protein Interaction Database dogra-2012-1 Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation dogra-2012-5 Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. in vitro In vitro phosphotransferase phosphotransferase assay phosphotransferase weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation dogra-2012-6 Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. in vitro In vitro spr surface plasmon resonance Optical biosensor BIAcore(r) BIAcore(r) Optical biosensor spr predetermined predetermined participant predetermined Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation dogra-2012-7 Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. in vitro In vitro molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation dogra-2012-2 Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. rhime Rhizobium meliloti Sinorhizobium meliloti fluorescence imaging fluorescence microscopy fluorescence imaging tag fluorescence tag visualisation by fluorescence tag fluorescence Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation dogra-2012-3 Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation dogra-2012-4 Sinorhizobium meliloti CheA complexed with CheS exhibits enhanced binding to CheY1, resulting in accelerated CheY1 dephosphorylation. in vitro In vitro protein kinase assay protein kinase assay weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Dogra G., Purschke F.G., Wagner V., Haslbeck M., Kriehuber T., Hughes J.G., Van Tassell M.L., Gilbert C., Niemeyer M., Ray W.K., Helm R.F., Scharf B.E. J. Bacteriol. (0021-9193) 2012 Only protein-protein interactions imex curation q52878_rhiml orf2 protein protein rhime Rhizobium meliloti Sinorhizobium meliloti MASRNSARNTLMLAPVLDLNEATVLHERLLALKGGAVAIDASAVERVGALCVQVLMAAARSWEADRLSFTFAEVSDAFIKTTQLIGADIGPLMAKEI chea_rhime Chemotaxis protein CheA SMc03007 R00639 cheA protein protein sinorhizobium melilo Rhizobium meliloti (strain 1021) (Ensifer meliloti) Sinorhizobium meliloti Ensifer meliloti MDMNEIKEIFFQECEEQLAELESGLLKLNDGDRDPETVNAVFRAVHSIKGGAGAFGLDDLVSFAHVFETTLDCVRSNRLEPNQDVLKVMLRSADVLADLTNAARDGGGVDEARSRQLIKELEALANGELPQAAAESAPKTTPAGVAPAAPVVNEEGFQPVAFSFDDFETGDEPTIEPSTYEIVFKPKSDLYSKGNDATLLLRDLSRLGEMSIHCNMDTLPPLDRMNPEEAYFSWKISLKTDKGEEAIRSVFEFAEWDCELDVALAGGTVGMDEDLPMQPVPFDLSILEDEAQAPAGEEDRAAASEGDSRNAAVAAAQTASNVLQMAQSTARVSPENARNSQSASAAQAAAQQAASAATPTIRVDLDRVDRLINLVGELVINQAMLSQSVIENDTNGTSSINMGLEELQQLTREIQDSVMAIRAQPVKPVFQRMSRIVREIADMTGKSVRLITEGENTEVDKTVIDKLAEPLTHMIRNAVDHGLETPEKRVAAGKNPEGTVRLTAKHRSGRIVIELADDGAGINREKVRQKAIDNDLIAADANLSDEEVDNLIFHAGFSTADKISDISGRGVGMDVVKRSIQALGGRINISSKPGQGSIFTMSLPLTLAVLDGMVVTVANQTLVVPLTAIVETLQPEASAIHSFGSSQRLISIRDSFCPLVDVGRILNFRGAQANPVEGVALLVESEGGGQRALMVDAIQGQRQVVIKSLEANYTHVPGIAAATILGDGRVALILDVDAIVAASRGQSLKPEMSLAAAG q52879_rhiml cheY1 CDO24_06200 CN171_21355 CN211_06605 GHK53_05490 protein protein rhime Rhizobium meliloti Sinorhizobium meliloti MKKRVLTVDDSRTIRNMLLVTLNNAGFETIQAEDGVEGLEKLDTANPDVIVTDINMPRLDGFGFIEGVRKNDRYRAVPILVLTTESDAEKKNRARQAGATGWIVKPFDPTKLIDAIERVTA q52884_rhiml CDO24_06225 CN171_21380 CN211_06630 GHK53_05465 cheY2 CEJ86_01705 CN070_16445 protein protein rhime Rhizobium meliloti Sinorhizobium meliloti MSLAEKIKVLIVDDQVTSRLLLGDALQQLGFKQITAAGDGEQGMKIMAQNPHHLVISDFNMPKMDGLGLLQAVRANPATKKAAFIILTAQGDRALVQKAAALGANNVLAKPFTIEKMKAAIEAVFGALK orf2-orf2-1 1339451 not-defined-1823060742 1339458 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli not-defined-1360413010 1339458 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false figure 2 chea-orf2-5 1339451 not-defined-1222872289 1339459 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli not-defined-87434680 1339458 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli direct interaction direct interaction false false false figure 2 chea-chey1-1 1339452 not-defined-1793413453 1339459 phosphate donor phosphate donor unspecified role unspecified role not-defined-1899927513 1339460 photon acceptor photon acceptor photon acceptor unspecified role unspecified role phosphotransfer phosphotransfer reaction phosphotransfer false false false figure 9 chea-chey2-2 1339452 not-defined-1793413453 1339459 phosphate donor phosphate donor unspecified role unspecified role ecolx Escherichia coli n/a 1339461 phosphate acceptor phosphate acceptor unspecified role unspecified role ecolx Escherichia coli phosphotransfer phosphotransfer reaction phosphotransfer false false false figure 9 chea-chey2-1 1339453 not-defined-230856708 1339459 unspecified role unspecified role bait bait not-defined-915836221 1339461 unspecified role unspecified role prey prey direct interaction direct interaction false false false 1339453 figure 10 chea-chey1 1339453 not-defined-1793413453 1339459 unspecified role unspecified role bait bait not-defined-1899927513 1339460 unspecified role unspecified role prey prey direct interaction direct interaction false false false 1339453 figure 10 chea-orf2-7 1339454 not-defined-1302999850 1339458 unspecified role unspecified role neutral component neutral component Stoichiometry: 1.0 not-defined-279339392 1339459 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 direct interaction direct interaction false false false figure 5 chea-orf2-8 1339454 not-defined-279339392 1339459 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 not-defined-1302999850 1339458 unspecified role unspecified role neutral component neutral component Stoichiometry: 2.0 direct interaction direct interaction false false false figure 5 chea-orf2-1 1339455 not-defined-1462595739 1339459 unspecified role unspecified role unspecified role unspecified role q52880-- Q52880-- rfp tag red fluorescent protein tag red fluorescent protein RFP red fluorescent protein RFP rfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-248356152 1339458 unspecified role unspecified role unspecified role unspecified role q52878-- Q52878-- egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 3 chea-orf2-2 1339456 not-defined-549093569 1339459 unspecified role unspecified role bait bait q52880-- Q52880-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false q52880-120-360 Q52880-120-360 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false ecolx Escherichia coli not-defined-888936286 1339458 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false figure 4 and 6 chea-2 1339457 n/a 1339459 putative self putative self putative self putative self ecolx Escherichia coli phosphorylation phosphorylation reaction phosphorylation false true false Fig. 8