IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ libert-2011-1 SIRT1 Activates MAO-A in the Brain to Mediate Anxiety and Exploratory Drive. mouse-brain Mus musculus brain brain Brain [cerebrum] anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Libert S., Pointer K., Bell E.L., Das A., Cohen D.E., Asara J.M., Kapur K., Bergmann S., Preisig M., Otowa T., Kendler K.S., Chen X., Hettema J.M., van den Oord E.J., Rubio J.P., Guarente L. Deacetylase assay has not been captured as the species of origin of the protein constructs could not be traced. leng@mit.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation libert-2011-2 SIRT1 Activates MAO-A in the Brain to Mediate Anxiety and Exploratory Drive. mouse-n2a Mouse neuroblastoma cells n2a Murine neuroblastoma cells anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Libert S., Pointer K., Bell E.L., Das A., Cohen D.E., Asara J.M., Kapur K., Bergmann S., Preisig M., Otowa T., Kendler K.S., Chen X., Hettema J.M., van den Oord E.J., Rubio J.P., Guarente L. Deacetylase assay has not been captured as the species of origin of the protein constructs could not be traced. leng@mit.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation libert-2011-3 SIRT1 Activates MAO-A in the Brain to Mediate Anxiety and Exploratory Drive. mouse-brain Mus musculus brain brain Brain [cerebrum] ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Libert S., Pointer K., Bell E.L., Das A., Cohen D.E., Asara J.M., Kapur K., Bergmann S., Preisig M., Otowa T., Kendler K.S., Chen X., Hettema J.M., van den Oord E.J., Rubio J.P., Guarente L. Deacetylase assay has not been captured as the species of origin of the protein constructs could not be traced. leng@mit.edu Cell (0092-8674) 2011 Only protein-protein interactions imex curation sir1_mouse NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 Sirt1 Sir2l1 SIR2alpha SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein mouse Mus musculus Mouse MADEVALALQAAGSPSAAAAMEAASQPADEPLRKRPRRDGPGLGRSPGEPSAAVAPAAAGCEAASAAAPAALWREAAGAAASAEREAPATAVAGDGDNGSGLRREPRAADDFDDDEGEEEDEAAAAAAAAAIGYRDNLLLTDGLLTNGFHSCESDDDDRTSHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRILQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRPQKELVHLSELPPTPLHISEDSSSPERTVPQDSSVIATLVDQATNNNVNDLEVSESSCVEEKPQEVQTSRNVENINVENPDFKAVGSSTADKNERTSVAETVRKCWPNRLAKEQISKRLEGNQYLFVPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPLEDESEIEEFYNGLEDDTERPECAGGSGFGADGGDQEVVNEAIATRQELTDVNYPSDKS hen2_mouse Helix-loop-helix protein 2 Nhlh2 Hen2 Nescient helix loop helix 2 protein protein mouse Mus musculus Mouse MMLSPDQAADSDHPSSTHSDPESLGGADTKVLGSVSDLEPVEEADGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV hen2_human Helix-loop-helix protein 2 NHLH2 BHLHA34 HEN2 KIAA0490 Class A basic helix-loop-helix protein 34 Nescient helix loop helix 2 protein protein human Homo sapiens Human MMLSPDQAADSDHPSSAHSDPESLGGTDTKVLGSVSDLEPVEEAEGDGKGGSRAALYPHPQQLSREEKRRRRRATAKYRSAHATRERIRVEAFNLAFAELRKLLPTLPPDKKLSKIEILRLAICYISYLNHVLDV sir1_human NAD-dependent protein deacetylase sirtuin-1 NAD-dependent protein deacylase sirtuin-1 SIRT1 SIR2L1 SIR2-like protein 1 Regulatory protein SIR2 homolog 1 protein protein human Homo sapiens Human MADEAALALQPGGSPSAAGADREAASSPAGEPLRKRPRRDGPGLERSPGEPGGAAPEREVPAAARGCPGAAAAALWREAEAEAAAAGGEQEAQATAAAGEGDNGPGLQGPSREPPLADNLYDEDDDDEGEEEEEAAAAAIGYRDNLLFGDEIITNGFHSCESDEEDRASHASSSDWTPRPRIGPYTFVQQHLMIGTDPRTILKDLLPETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKIIVLTGAGVSVSCGIPDFRSRDGIYARLAVDFPDLPDPQAMFDIEYFRKDPRPFFKFAKEIYPGQFQPSLCHKFIALSDKEGKLLRNYTQNIDTLEQVAGIQRIIQCHGSFATASCLICKYKVDCEAVRGDIFNQVVPRCPRCPADEPLAIMKPEIVFFGENLPEQFHRAMKYDKDEVDLLIVIGSSLKVRPVALIPSSIPHEVPQILINREPLPHLHFDVELLGDCDVIINELCHRLGGEYAKLCCNPVKLSEITEKPPRTQKELAYLSELPPTPLHVSEDSSSPERTSPPDSSVIVTLLDQAAKSNDDLDVSESKGCMEEKPQEVQTSRNVESIAEQMENPDLKNVGSSTGEKNERTSVAGTVRKCWPNRVAKEQISRRLDGNQYLFLPPNRYIFHGAEVYSDSEDDVLSSSSCGSNSDSGTCQSPSLEEPMEDESEIEEFYNGLEDEPDVPERAGGAGFGTDGDDQEAINEAISVKQEVTDMNYPSNKS maoa_mouse_gene Amine oxidase [flavin-containing] A gene gene mouse Mus musculus Mouse nhlh2-sirt1 1266775 n/a 1266778 unspecified role unspecified role prey prey n/a 1266779 unspecified role unspecified role bait bait physical association physical association false false false Supp. Fig. 3B sirt1-nhlh2 1266775 n/a 1266778 unspecified role unspecified role bait bait n/a 1266779 unspecified role unspecified role prey prey physical association physical association false false false Supp. Fig. 3C sirt1-nhlh2-1 1266776 n/a 1266780 unspecified role unspecified role prey prey region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1266781 unspecified role unspecified role bait bait region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 3E nhlh2-sirt1-1 1266776 n/a 1266781 unspecified role unspecified role prey prey region v5 tag v5 tag GKPIPNPLLGLDST epitope tag GKPIPNPLLGLDST epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1266780 unspecified role unspecified role bait bait region myc tag myc tag EUKLISEED epitope tag EUKLISEED epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Supp. Fig. 3D sirt1-maoa 1266777 n/a 1266782 unspecified role unspecified role prey prey promoter region binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1266778 unspecified role unspecified role bait bait association association false false false Fig. 3A