MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint sulowayc-2012-1 Tail-anchor targeting by a Get3 tetramer: the structure of an archaeal homologue. ecoli Escherichia coli (strain K12) pull down pull down predetermined predetermined participant predetermined Suloway CJ., Rome ME., Clemons WM. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation sulowayc-2012-2 Tail-anchor targeting by a Get3 tetramer: the structure of an archaeal homologue. in vitro In vitro light scattering light scattering predetermined predetermined participant predetermined Suloway CJ., Rome ME., Clemons WM. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation suloway-2012-1 Tail-anchor targeting by a Get3 tetramer: the structure of an archaeal homologue. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Suloway CJ., Rome ME., Clemons WM. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation arsa_metja Putative arsenical pump-driving ATPase Arsenical resistance ATPase Arsenite-translocating ATPase Arsenite-transporting ATPase MJ1142 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MLSKIKDSINSLRGITEKKLEKKDGTKYIMFGGKGGVGKTTMSAATGVYLAEKGLKVVIVSTDPAHSLRDIFEQEFGHEPTKVKGYDNLYVVEIDPQKAMEEYKEKLKAQIEENPFLGEMLEDQLEMAALSPGTDESAAFDVFLKYMDSNEFDVVIFDTAPTGHTLRFLGMPEVMDKYMTKLIKLRKQMSGFMKMMKKLLPFGGKDEDIDYDKMLEELEKMKERIVRARNILSDPERTAFRLVVIPEEMSILESERAMKALQKYGIPIDAVIVNQLIPEDVQCDFCRARRELQLKRLEMIKEKFGDKVIAYVPLLRTEAKGIETLKQIAKILYGEEEKEEQKIEQKVGQ mint secg_metja Preprotein translocase subunit SecG secG Protein transport protein Sec61 subunit beta homolog MJ0912.1 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MSKREETGLATSAGLIRYMDETFSKIRVKPEHVIGVTVAFVIIEAILTYGRFL mint sece_metja Protein translocase subunit SecE secE Protein transport protein Sec61 gamma subunit homolog MJ0371 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MKTDFNQKIEQLKEFIEECRRVWLVLKKPTKDEYLAVAKVTALGISLLGIIGYIIHVPATYIKGILKPPTTPRV mint mtra_metja Tetrahydromethanopterin S-methyltransferase subunit A mtrA N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit A MJ0851 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MANKREPAPGWPIVSGEYVVGNPESCVGVVTLGSHGLEQACIDAGAAIAGPCHTENLGIEKVVANYISNPNIRFMILCGSEVQGHITGQCFKALWENGIGDDGGIIGAKGAIPFLENVNKEAVERFRRQIVEVVDLIDCEDIGKITQAIKECLSKDPGAIDEDPFIIELEGGKGGGEEEEGVIKPITPEMAIIESRMRLIGNEMCYNGLLAKWQAGYYNGKIQGIATGLFLMLLIMGILMF mint mtrb_metja Tetrahydromethanopterin S-methyltransferase subunit B mtrB N5-methyltetrahydromethanopterin--coenzyme M methyltransferase subunit B MJ0850 protein protein metja Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) Methanococcus jannaschii MATYVFIDQNIPLVYTVETGVITKGFGDLLFVDVSPIEEQIKKLETLVDAYEHSLDPRYPPLNSFPNRDGVYAISGYFKSAFFGFWIGLGIMALLAIILGVKF mint sc6b1_yeast Protein transport protein SBH1 Sec61 complex subunit SBH1 YER087BC YER087C-B SBH1 SEB1 Sec61 complex subunit beta protein protein yeast Saccharomyces cerevisiae Baker's yeast MSSPTPPGGQRTLQKRKQGSSQKVAASAPKKNTNSNNSILKIYSDEATGLRVDPLVVLFLAVGFIFSVVALHVISKVAGKLF get3_yeast ATPase GET3 YDL100C GET3 ARR4 D2371 Arsenical pump-driving ATPase Arsenite-stimulated ATPase Guided entry of tail-anchored proteins 3 Golgi to ER traffic protein 3 protein protein yeast Saccharomyces cerevisiae Baker's yeast MDLTVEPNLHSLITSTTHKWIFVGGKGGVGKTTSSCSIAIQMALSQPNKQFLLISTDPAHNLSDAFGEKFGKDARKVTGMNNLSCMEIDPSAALKDMNDMAVSRANNNGSDGQGDDLGSLLQGGALADLTGSIPGIDEALSFMEVMKHIKRQEQGEGETFDTVIFDTAPTGHTLRFLQLPNTLSKLLEKFGEITNKLGPMLNSFMGAGNVDISGKLNELKANVETIRQQFTDPDLTTFVCVCISEFLSLYETERLIQELISYDMDVNSIIVNQLLFAENDQEHNCKRCQARWKMQKKYLDQIDELYEDFHVVKMPLCAGEIRGLNNLTKFSQFLNKEYNPITDGKVIYELEDKE F795C359B5A4A461 q5jif4_theko TK0994 protein protein theko Thermococcus kodakaraensis (strain ATCC BAA-918 / JCM 12380 / KOD1) Pyrococcus kodakaraensis (strain KOD1) MREFFLPKKDYRVVFFIGKGGVGKTTSSAAAAVALADKGYRTLIVSLDPAHNLGDVLMEKLSDKPKKIAENLYASELDMEKLIKSYLKHLEENLKHMYRYLTVINLEKYFEVLSFSPGIEEYATLEAVKEILMKGDEWDVIVFDTPPTGLTLRVLALPRISLIWTDKLIEIRRAILERRAAIANIHGEQEFVVEGERIKLPTKEEEDPVMKELKAYRKEVAFVESVLTDPDKTSVVAVMNPEMLPLYETERAYESLKKFRIPFNMIVMNKVFELKGEVPELKAKLEAQERVLMEVSEKFKGVDIVKIPIFPEEPRGVERLRELGGAIIGER mint arsa-secg 1292991 arsa_metja GET3 1292994 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait partially purified partially purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false secg_metja Sec beta 1292995 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey partially purified partially purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3b mint arsa-sece 1292991 sece_metja Sec E 1292996 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey partially purified partially purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arsa_metja GET3 1292994 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait partially purified partially purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3b mint arsa-mtra 1292991 arsa_metja GET3 1292994 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait partially purified partially purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false mtra_metja mtrA 1292997 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey partially purified partially purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3b mint arsa-mtrb 1292991 mtrb_metja mtrB 1292998 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey partially purified partially purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false arsa_metja GET3 1292994 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait partially purified partially purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3b mint arsa-sbh1 1292991 arsa_metja GET3 1292994 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait partially purified partially purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sc6b1_yeast Sbh1 1292999 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey partially purified partially purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3b mint get3-sbh1 1292991 sc6b1_yeast Sbh1 1292999 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey partially purified partially purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false get3_yeast GET3 1293000 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait partially purified partially purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3b mint q5jif4-sbh1 1292991 tkget3 GET3 1293001 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait partially purified partially purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false sc6b1_yeast Sbh1 1292999 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey partially purified partially purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3b mint q5jif4-mtrb 1292991 mtrb_metja mtrB 1292998 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey partially purified partially purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tkget3 GET3 1293001 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait partially purified partially purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3b mint q5jif4-mtra 1292991 tkget3 GET3 1293001 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait partially purified partially purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false mtra_metja mtrA 1292997 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey partially purified partially purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3b mint q5jif4-sece 1292991 sece_metja Sec E 1292996 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey partially purified partially purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false tkget3 GET3 1293001 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait partially purified partially purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3b mint q5jif4-secg 1292991 tkget3 GET3 1293001 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false secg_metja Sec beta 1292995 weight by comassie molecular weight estimation by coomasie staining weight by comassie unspecified role unspecified role prey prey partially purified partially purified mbp tag mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false f3b mint arsa-1 1292992 arsa_metja GET3 1292994 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q58542:p.Met193Asp mutation increasing interaction mutation increasing mutation increasing interaction mutation increasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 4.0 direct interaction direct interaction false false false mint f4d f4e f5b t1 get3-3 1292992 get3_yeast GET3 1293000 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 4.0 direct interaction direct interaction false false false mint f4a f4b f5b t1 get3-3 1292992 get3_yeast GET3 1293000 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Stoichiometry: 2.0 direct interaction direct interaction false false false mint f4a f4b f5b t1 arsa-1 1292992 arsa_metja GET3 1292994 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified Q58542:p.Phe192Asp mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q58542:p.Met196Asp mutation increasing interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false mint f4d f5b t1 f4e arsa-1 1292993 arsa_metja GET3 1292994 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Stoichiometry: 4.0 direct interaction direct interaction false false false mint f1a f1b f2 sf2 st1