MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint fromm-2012-1 The structural basis of Edc3- and Scd6-mediated activation of the Dcp1:Dcp2 mRNA decapping complex. in vitro In vitro nmr nuclear magnetic resonance NMR NMR nmr predetermined predetermined participant predetermined Fromm SA., Truffault V., Kamenz J., Braun JE., Hoffmann NA., Izaurralde E., Sprangers R. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation fromm-2012-3 The structural basis of Edc3- and Scd6-mediated activation of the Dcp1:Dcp2 mRNA decapping complex. schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast fluorescence imaging fluorescence microscopy fluorescence imaging predetermined predetermined participant predetermined Fromm SA., Truffault V., Kamenz J., Braun JE., Hoffmann NA., Izaurralde E., Sprangers R. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation fromm-2012-2 The structural basis of Edc3- and Scd6-mediated activation of the Dcp1:Dcp2 mRNA decapping complex. in vitro In vitro pull down pull down predetermined predetermined participant predetermined Fromm SA., Truffault V., Kamenz J., Braun JE., Hoffmann NA., Izaurralde E., Sprangers R. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation dcp2_schpo mRNA decapping complex subunit 2 dcp2 SPAC19A8.12 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSFTNATFSQVLDDLSARFILNLPAEEQSSVERLCFQIEQAHWFYEDFIRAQNDQLPSLGLRVFSAKLFAHCPLLWKWSKVHEEAFDDFLRYKTRIPVRGAIMLDMSMQQCVLVKGWKASSGWGFPKGKIDKDESDVDCAIREVYEETGFDCSSRINPNEFIDMTIRGQNVRLYIIPGISLDTRFESRTRKEISKIEWHNLMDLPTFKKNKPQTMKNKFYMVIPFLAPLKKWIKKRNIANNTTKEKNISVDVDADASSQLLSLLKSSTAPSDLATPQPSTFPQPPVESHSSFDIKQKILHLLNEGNEPKSPIQLPPVSNLPLNPPIQSSNSRLSHDNNSFDPFAYLGLDPKNPSASFPRVVSQNNMLTNKPVLNNHFQQSMYSNLLKDQNSVQHLFAASDMPSPMELPSPSTVYHQVFYPPTSTSVSSYGLGKTPQPAYGSSSPYVNGHQTQQISSLPPFQSQTQFLARNSDNSGQSYNSEGDSNSKRLLSMLSQQDTTPSSSTLSKEANVQLANLFLTPNSLETKKFSDNSQGEEISDNLHGESCNNPNANSVHSAQLLQALLHPSATETKEETPKKTSDSLSLLTLLKSGLPTPANDLQNKSQNNERKASSQVKELEVKNYSKSTDLLKKTLRIPRNDEPLEAANQFDLLKVSPQQKSEVPPKRNELSQSKLKNRKKKENSETNKNHVDMSPGFVKILKRSPLADQKKEDTQESDFKGSDDHFLSYLQSVVSSNSNGLH B405257B706BC5C0 edc3_schpo Enhancer of mRNA-decapping protein 3 edc3 SPBC18E5.11c SPBC23G7.01c protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MSVADFYGSNVEVLLNNDSKARGVITNFDSSNSILQLRLANDSTKSIVTKDIKDLRILPKNEIMPKNGTKSPSTNSTKLKSAETYSSKNKWSMDCDEEFDFAANLEKFDKKQVFAEFREKDKKDPAKLLVSHNKSPNRNYHHKQNVLGPSVKDEFVDLPSAGSQINGIDAVLSSSSNGHVTPGSKKGSRETLKKKPFVDENIPAELHTTTGDILKPITPEQLSQGIALAIAKTSTDIVVENAAQLLSQFVFSVLGGHKRLSSRNHNSQPLVCILVGSHDHASAAVAAGRRLCAIGIKVVLRLLTPFNVDNRQLLMFQAAGGYIPTENFDQFLNKLTSPIELVVDVLTGFHPSIDKNSHALIQWANDLNVLILSVDIPSGYTVQKKNTAILPKWTLALGAVTTTLAQAALVKQAAGVSVFVGNLGTGSQTWAELGILESQVTGQYLAQISCTSTN mint sum2_schpo Protein sum2 sum2 SPBC800.09 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MTEFIGSRISLISKSDIRYVGILQDINSQDSTLALKHVRWCGTEGRKQDPSQEIPPSDNVFDYIVFRGSDVKDLRIEEPATTPSAPPVQPPNDPAIIGSNSGQYNWNQAQTAQPPQPVQPNPYGAPYQQAPPAGAPYYMYPNAPAQFVPPGGLPLGTPLDASTPAVPYYGAPDQQQMGQRPEFAQNVSQGFAGQAPYNVRPGYGMPSNQKPPNFAPGMPAPGPTAVSASPSLQSMPPTNGVIPGAQPSIEASIEKESTSIRNSTVTNDRVVNTTVDVSQSQTVETSGPSKEVPTTQPDASAAKPRTEFDFQTANQKFQSMKDDLLKGKNDEEAEEFYKPKQSFFDNISCESKEKGMEAADRRALRDRERSLNMETFGVAGSGNRGRRGRGRGRGGRGRGRGYARNQYNQYRNSNGSQPRAQPANDQ dcp1_schpo mRNA-decapping enzyme subunit 1 dcp1 SPBC3B9.21 protein protein schpo Schizosaccharomyces pombe (strain ATCC 38366 / 972) Fission yeast MEDENILRNAVNLQVLKFHYPEIESIIDIASHVAVYQFDVGSQKWLKTSIEGTFFLVKDQRARVGYVILNRNSPENLYLFINHPSNVHLVDRYLIHRTENQHVVGLWMFDPNDMSRIFNIVKESLLR DD593F646C61EEC0 mint dcp2-edc3-1 1284789 dcp2_schpo dcp2 1284792 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false ybsb_schpo EDC3 1284793 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false mint f1e f2a f2b sf3 sf2 st1b st1c dcp2-edc3-2 1284789 dcp2_schpo dcp2 1284792 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ybsb_schpo EDC3 1284793 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3c mint dcp2-edc3-3 1284789 dcp2_schpo dcp2 1284792 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ybsb_schpo EDC3 1284793 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false mint f3c sf6a sf6b dcp2-edc3-4 1284789 dcp2_schpo dcp2 1284792 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false ybsb_schpo EDC3 1284793 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f3c mint dcp2-sum2 1284789 sum2_schpo Scd6 1284794 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dcp2_schpo dcp2 1284792 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f4b mint dcp2-sum2-1 1284789 sum2_schpo Scd6 1284794 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dcp2_schpo dcp2 1284792 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f4b mint dcp2-sum2-2 1284789 sum2_schpo Scd6 1284794 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false dcp2_schpo dcp2 1284792 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false f4b mint dcp2-sum2-3 1284789 dcp2_schpo dcp2 1284792 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false sum2_schpo Scd6 1284794 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false mint f4b sf7 dcp1-dcp2-1 1284790 dcp2_schpo dcp2 1284792 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dcp1_schpo dcp1 1284795 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f6a mint dcp2-edc3-5 1284790 dcp2_schpo dcp2 1284792 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell gfp tag gfp tag green fluorescent protein tag GFP green fluorescent protein GFP green fluorescent protein gfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ybsb_schpo EDC3 1284793 tag fluorescence tag visualisation by fluorescence tag fluorescence unspecified role unspecified role neutral component neutral component over-expressed over expressed level over-expressed fixed cell fixed cell fusion protein fusion protein fusion protein undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false f6b mint dcp1-dcp1 1284791 dcp2_schpo dcp2 1284792 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role prey prey purified purified ybsb_schpo EDC3 1284793 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role prey prey purified purified dcp1_schpo dcp1 1284795 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role bait bait purified purified his tag his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false dcp1_schpo dcp1 1284795 weight by staining molecular weight estimation by staining weight by staining unspecified role unspecified role prey prey purified purified physical association physical association false false false f3d mint