MINT MINT, Dpt of Biology, University of Rome Tor Vergata MINT http://mint.bio.uniroma2.it/mint url>http://mint.bio.uniroma2.it/mint/ https://mint.bio.uniroma2.it MINT-[0-9]+ https://mint.bio.uniroma2.it/index.php/results-interactions/?id=${ac} The Molecular INTeraction database (MINT) is a relational database designed to store interactions between biological molecules. http://mint.bio.uniroma2.it http://mint.bio.uniroma2.it/mint yuan-2012a-3 MYST protein acetyltransferase activity requires active site lysine autoacetylation. in vitro In vitro enzymatic study enzymatic study predetermined predetermined participant predetermined Yuan H., Rossetto D., Mellert H., Dang W., Srinivasan M., Johnson J., Hodawadekar S., Ding EC., Speicher K., Abshiru N., Perry R., Wu J., Yang C., Zheng YG., Speicher DW., Thibault P., Verreault A., Johnson FB., Berger SL., Sternglanz R., McMahon SB., Côté J., Marmorstein R. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation yuan-2012a-2 MYST protein acetyltransferase activity requires active site lysine autoacetylation. in vitro In vitro deacetylase assay deacetylase assay predetermined predetermined participant predetermined Yuan H., Rossetto D., Mellert H., Dang W., Srinivasan M., Johnson J., Hodawadekar S., Ding EC., Speicher K., Abshiru N., Perry R., Wu J., Yang C., Zheng YG., Speicher DW., Thibault P., Verreault A., Johnson FB., Berger SL., Sternglanz R., McMahon SB., Côté J., Marmorstein R. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation yuan-2012a-1 MYST protein acetyltransferase activity requires active site lysine autoacetylation. in vitro In vitro x-ray diffraction x-ray crystallography X-ray X-ray x-ray diffraction predetermined predetermined participant predetermined Yuan H., Rossetto D., Mellert H., Dang W., Srinivasan M., Johnson J., Hodawadekar S., Ding EC., Speicher K., Abshiru N., Perry R., Wu J., Yang C., Zheng YG., Speicher DW., Thibault P., Verreault A., Johnson FB., Berger SL., Sternglanz R., McMahon SB., Côté J., Marmorstein R. EMBO J. (0261-4189) 2012 Only protein-protein interactions imex curation esa1_yeast Histone acetyltransferase ESA1 ESA1 O5257 YOR244W protein protein yeast Saccharomyces cerevisiae Baker's yeast MSHDGKEEPGIAKKINSVDDIIIKCQCWVQKNDEERLAEILSINTRKAPPKFYVHYVNYNKRLDEWITTDRINLDKEVLYPKLKATDEDNKKQKKKKATNTSETPQDSLQDGVDGFSRENTDVMDLDNLNVQGIKDENISHEDEIKKLRTSGSMTQNPHEVARVRNLNRIIMGKYEIEPWYFSPYPIELTDEDFIYIDDFTLQYFGSKKQYERYRKKCTLRHPPGNEIYRDDYVSFFEIDGRKQRTWCRNLCLLSKLFLDHKTLYYDVDPFLFYCMTRRDELGHHLVGYFSKEKESADGYNVACILTLPQYQRMGYGKLLIEFSYELSKKENKVGSPEKPLSDLGLLSYRAYWSDTLITLLVEHQKEITIDEISSMTSMTTTDILHTAKTLNILRYYKGQHIIFLNEDILDRYNRLKAKKRRTIDPNRLIWKPPVFTASQLRFAW 9E970F744D0B9E18 h4_yeast Histone H4 N2752 YBR0122 YBR009C YNL030W HHF1 HHF2 protein protein yeast Saccharomyces cerevisiae Baker's yeast MSGRGKGGKGLGKGGAKRHRKILRDNIQGITKPAIRRLARRGGVKRISGLIYEEVRAVLKSFLESVIRDSVTYTEHAKRKTVTSLDVVYALKRQGRTLYGFGG 69B7D1F89E62DE41 kat8_human Histone acetyltransferase KAT8 KAT8 MOF PP7073 MOZ, YBF2/SAS3, SAS2 and TIP60 protein 1 MYST1 Lysine acetyltransferase 8 protein protein human Homo sapiens Human MAAQGAAAAVAAGTSGVAGEGEPGPGENAAAEGTAPSPGRVSPPTPARGEPEVTVEIGETYLCRRPDSTWHSAEVIQSRVNDQEGREEFYVHYVGFNRRLDEWVDKNRLALTKTVKDAVQKNSEKYLSELAEQPERKITRNQKRKHDEINHVQKTYAEMDPTTAALEKEHEAITKVKYVDKIHIGNYEIDAWYFSPFPEDYGKQPKLWLCEYCLKYMKYEKSYRFHLGQCQWRQPPGKEIYRKSNISVYEVDGKDHKIYCQNLCLLAKLFLDHKTLYFDVEPFVFYILTEVDRQGAHIVGYFSKEKESPDGNNVACILTLPPYQRRGYGKFLIAFSYELSKLESTVGSPEKPLSDLGKLSYRSYWSWVLLEILRDFRGTLSIKDLSQMTSITQNDIISTLQSLNMVKYWKGQHVICVTPKLVEEHLKSAQYKKPPITVDSVCLKWAPPKHKQVKLSKK hst2_yeast NAD-dependent protein deacetylase HST2 HST2 Homologous to SIR2 protein 2 Regulatory protein SIR2 homolog 2 LPA2C YPL015C protein protein yeast Saccharomyces cerevisiae Baker's yeast MSVSTASTEMSVRKIAAHMKSNPNAKVIFMVGAGISTSCGIPDFRSPGTGLYHNLARLKLPYPEAVFDVDFFQSDPLPFYTLAKELYPGNFRPSKFHYLLKLFQDKDVLKRVYTQNIDTLERQAGVKDDLIIEAHGSFAHCHCIGCGKVYPPQVFKSKLAEHPIKDFVKCDVCGELVKPAIVFFGEDLPDSFSETWLNDSEWLREKITTSGKHPQQPLVIVVGTSLAVYPFASLPEEIPRKVKRVLCNLETVGDFKANKRPTDLIVHQYSDEFAEQLVEELGWQEDFEKILTAQGGMGDNSKEQLLEIVHDLENLSLDQSEHESADKKDKKLQRLNGHDSDEDGASNSSSSQKAAKE esa1-hhf1-1 1272600 esa1_yeast ESA1 1272603 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q08649:p.Lys262Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false h4_yeast H4 1272604 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false acetylation acetylation reaction acetylation false false false f2b mint hhf1-kat8 1272600 h4_yeast H4 1272604 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false myst1_human MOF 1272605 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q9H7Z6:p.Lys274Arg mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false acetylation acetylation reaction acetylation false false false f2b mint esa1-hhf1-2 1272600 h4_yeast H4 1272604 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false esa1_yeast ESA1 1272603 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q08649:p.Lys262Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false acetylation acetylation reaction acetylation false false false sf3 mint esa1-hhf1-3 1272600 esa1_yeast ESA1 1272603 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified Q08649:p.Lys262Gln mutation disrupting interaction mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false h4_yeast H4 1272604 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false acetylation acetylation reaction acetylation false false false sf3 mint hhf1-kat8-1 1272600 myst1_human MOF 1272605 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false Q9H7Z6:p.Lys274Ala mutation disrupting interaction mutation disrupting mutation disrupting interaction mutation disrupting mutation analysis mutation analysis certain certain sequence position certain certain certain sequence position certain false h4_yeast H4 1272604 predetermined predetermined participant predetermined enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false acetylation acetylation reaction acetylation false false false sf3 mint esa1-hst2 1272601 hst2_yeast HST2 1272606 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified esa1_yeast ESA1 1272603 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false acetylated residue acetylated residue ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm deacetylation deacetylation reaction deacetylation false false false homomint mint t2 f1f hst2-kat8 1272601 myst1_human MOF 1272605 ms participant Identification by mass spectrometry ms participant enzyme target enzyme target substrate substrate neutral component neutral component purified purified acetylated residue acetylated residue ac1res monoacetylated residue Acetyl Acetylation (N terminus, N epsilon of Lysine, O of Serine) (Ac) Acetylation Ac1Res modified residue ms mass detection of residue modification modified residue ms certain certain sequence position certain certain certain sequence position certain false prerequisite-ptm binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false hst2_yeast HST2 1272606 predetermined predetermined participant predetermined enzyme enzyme neutral component neutral component purified purified deacetylation deacetylation reaction deacetylation false false false homomint mint t2 f1f esa1-hhf1 1272602 esa1_yeast ESA1 1272603 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false h4_yeast H4 1272604 predetermined predetermined participant predetermined unspecified role unspecified role neutral component neutral component purified purified binding site binding region binding-associated region binding region certain certain sequence position certain certain certain sequence position certain false direct interaction direct interaction false false false mint t1 f1a