I2D I2D beekman-2012-1 Syntenin-mediated regulation of Sox4 proteasomal degradation modulates transcriptional output. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Beekman J.M., Vervoort S.J., Dekkers F., van Vessem M.E., Vendelbosch S., Brugulat-Panes A., van Loosdregt J., Braat A.K., Coffer P.J. Cancer - Interactions investigated in the context of cancer p.j.coffer@umcutrecht.nl Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database beekman-2012-2 Syntenin-mediated regulation of Sox4 proteasomal degradation modulates transcriptional output. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Beekman J.M., Vervoort S.J., Dekkers F., van Vessem M.E., Vendelbosch S., Brugulat-Panes A., van Loosdregt J., Braat A.K., Coffer P.J. Cancer - Interactions investigated in the context of cancer p.j.coffer@umcutrecht.nl Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database beekman-2012-3 Syntenin-mediated regulation of Sox4 proteasomal degradation modulates transcriptional output. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. confocal microscopy confocal microscopy immunostaining immunostaining Beekman J.M., Vervoort S.J., Dekkers F., van Vessem M.E., Vendelbosch S., Brugulat-Panes A., van Loosdregt J., Braat A.K., Coffer P.J. Cancer - Interactions investigated in the context of cancer p.j.coffer@umcutrecht.nl Oncogene (0950-9232) 2012 Only protein-protein interactions imex curation Curated by: I2D - Interologous Interaction Database sox4_mouse Transcription factor SOX-4 Sox4 Sox-4 protein protein mouse Mus musculus Mouse MVQQTNNAENTEALLAGESSDSGAGLELGIASSPTPGSTASTGGKADDPSWCKTPSGHIKRPMNAFMVWSQIERRKIMEQSPDMHNAEISKRLGKRWKLLKDSDKIPFIQEAERLRLKHMADYPDYKYRPRKKVKSGNAGAGSAATAKPGEKGDKVAGSSGHAGSSHAGGGAGGSSKPAPKKSCGPKVAGSSVGKPHAKLVPAGGSKAAASFSPEQAALLPLGEPTAVYKVRTPSAATPAASSSPSSALATPAKHPADKKVKRVYLFGSLGASASPVGGLGASADPSDPLGLYEDGGPGCSPDGRSLSGRSSAASSPAASRSPADHRGYASLRAASPAPSSAPSHASSSLSSSSSSSSGSSSSDDEFEDDLLDLNPSSNFESMSLGSFSSSSALDRDLDFNFEPGSGSHFEFPDYCTPEVSEMISGDWLESSISNLVFTY sdcb1_human Syntenin-1 Scaffold protein Pbp1 Pro-TGF-alpha cytoplasmic domain-interacting protein 18 Syndecan-binding protein 1 Melanoma differentiation-associated protein 9 SDCBP MDA9 SYCL protein protein human Homo sapiens Human MSLYPSLEDLKVDKVIQAQTAFSANPANPAILSEASAPIPHDGNLYPRLYPELSQYMGLSLNEEEIRANVAVVSGAPLQGQLVARPSSINYMVAPVTGNDVGIRRAEIKQGIREVILCKDQDGKIGLRLKSIDNGIFVQLVQANSPASLVGLRFGDQVLQINGENCAGWSSDKAHKVLKQAFGEKITMTIRDRPFERTITMHKDSTGHVGFIFKNGKITSIVKDSSAARNGLLTEHNICEINGQNVIGLKDSQIADILSTSGTVVTITIMPAFIFEHIIKRMAPSIMKSLMDHTIPEV sox4-sdcbp 1311448 n/a 1311451 unspecified role unspecified role bait bait region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false region sufficient to bind sufficient binding region sufficient to bind deletion analysis deletion analysis certain certain sequence position certain certain certain sequence position certain false n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1311452 unspecified role unspecified role prey prey region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false 4d sdcbp-sox4 1311449 n/a 1311452 unspecified role unspecified role neutral component neutral component region mkate2 mkate2 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1311451 unspecified role unspecified role neutral component neutral component region egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 5a,b sdcbp-sox4-1 1311450 n/a 1311451 unspecified role unspecified role neutral component neutral component n-terminus flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1311452 unspecified role unspecified role neutral component neutral component region ha tag ha tag YPYDVPDYA epitope tag YPYDVPDYA epitope tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false colocalization colocalization false false false 5d,e Sox4 mutants that fail to localize to the nucleus fail to induce nuclear relocalization of syntenin suggesting that Sox4 modulates syntenin subcellular localization.