mpidb The Microbial Protein Interaction Database schu-2011-1 Probing the impact of ligand binding on the acyl-homoserine lactone-hindered transcription factor EsaR of Pantoea stewartii subsp. stewartii. ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Schu D.J., Ramachandran R., Geissinger J.S., Stevens A.M. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation schu-2011-2 Probing the impact of ligand binding on the acyl-homoserine lactone-hindered transcription factor EsaR of Pantoea stewartii subsp. stewartii. in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Schu D.J., Ramachandran R., Geissinger J.S., Stevens A.M. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation esar_panse Transcriptional activator protein EsaR esaR protein protein erwst Erwinia stewartii MFSFFLENQTITDTLQTYIQRKLSPLGSPDYAYTVVSKKNPSNVLIISSYPDEWIRLYRANNFQLTDPVILTAFKRTSPFAWDENITLMSDLRFTKIFSLSKQYNIVNGFTYVLHDHMNNLALLSVIIKGNDQTALEQRLAAEQGTMQMLLIDFNEQMYRLAGTEGERAPALNQSADKTIFSSRENEVLYWASMGKTYAEIAAITGISVSTVKFHIKNVVVKLGVSNARQAIRLGVELDLIRPAASAAR esar-esar 1339118 not-defined-1692411263 1339120 unspecified role unspecified role unspecified role unspecified role region P54293-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false Stoichiometry: 2.0 physical association physical association false false false figure 4 esar-esar-2 1339119 not-defined-2039217695 1339120 unspecified role unspecified role neutral component neutral component region P54293-1-178 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false region mbp tag maltose binding protein tag maltose binding protein tag maltose binding protein tag mbp tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli Stoichiometry: 2.0 direct interaction direct interaction false false false figure 5