mpidb The Microbial Protein Interaction Database mcmanus-2011-1 The CgrA and CgrC proteins form a complex that positively regulates cupA fimbrial gene expression in Pseudomonas aeruginosa. ecolx Escherichia coli 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined McManus H.R., Dove S.L. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation mcmanus-2011-2 The CgrA and CgrC proteins form a complex that positively regulates cupA fimbrial gene expression in Pseudomonas aeruginosa. pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) tap tandem affinity purification TAP TAP tap western blot western blot Immuno blot Immuno blot McManus H.R., Dove S.L. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation q9i1y9_pseae ParB domain-containing protein PA2126 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MAQTKTLTERAEALFGELHGLPLAERIEAINRIRRLLHAHSPFAEEPVDCVQWVRAERVAGNDYNPNTVAPPEMRLLRLSIESDGFTQPIVAYPQADGRYEVVDGFHRLRVGSAKGALRQRLHGYLPIAAIRAGREGDSERIAATIRHNRARGVHGVLPMTAIVVTLLKAGWSEADVARELGMDNDEVLRFKQVSGLPELFREHVYSRSWE q9i1y8_pseae PAPS_reduct domain-containing protein PA2127 protein protein pseae Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) MAGKHYQDADVHAATLSRLRLVFRNFERVCVAFSGGKDSSVTLQLALDVARELGRSPVDVLFIDLEGQYQATIDHVSEMLGRPDVRPWWVCLPLNLRNASSLEEPYWCCWEPGAEADWVRPLPKQRGVISDPAFFPFYRYRMEFEEFVAGFNAWLAREEPTAFLVGIRSDESLNRYLAVKRRSRAKQCAWTPPGGSAPLAWSARDRANPQAVSFFPIYDWRFEDLWRCVADHGYAYNRLYDQMYRAGVPFSQMRICQPYGDDQRKGLDLFHRIEPRTWFKVVRRVAGANYGARYCRQRFLGYRGGLGLPPSFGTWREYSQFLLRSMPPPLRGIYQRRIERFILWWKQHDYPLAIWPDAGIPALENRRKQPSWRRIALSLLKQDMARSLSFGFSQADIDRLVPGREKRS q9i1y9_pseae-q9i1y9_pseae-1 1339097 not-defined-856333281 1339099 unspecified role unspecified role prey prey region Q9I1Y9-2-87 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false Q9I1Y9:p.Leu197Ser Q9I1Y9-197-197 mutation with no effect mutation with no effect mutation with no effect mutation not affecting interaction certain certain sequence position certain certain certain sequence position certain false not-defined-928071629 1339099 unspecified role unspecified role bait bait q9i1y9-88-211 Q9I1Y9-88-211 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false Figure 1 q9i1y9-q9i1y8 1339097 not-defined-1737502815 1339100 unspecified role unspecified role prey prey region Q9I1Y8-2-247 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false not-defined-582446794 1339099 unspecified role unspecified role bait bait region Q9I1Y9-170-211 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false Q9I1Y9:p.Leu197Ser Q9I1Y9-197-197 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 1 q9i1y8-q9i1y9 1339098 not-defined-1616813404 1339100 unspecified role unspecified role bait bait q9i1y8-- Q9I1Y8-- tap tagged calmodulin binding peptide plus protein a tag CBP-ProtA tagged CBP-ProtA tagged tap tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1248895450 1339099 unspecified role unspecified role prey prey Q9I1Y9:p.Leu197Ser Q9I1Y9-197-197 mutation mutation certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 4