IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ zhuo-2011-1 The beta-catenin binding protein ICAT modulates androgen receptor activity. in vitro In vitro pull down pull down weight autoradiogra molecular weight estimation by autoradiography weight autoradiogra Zhuo M., Zhu C., Sun J., Weis W.I., Sun Z. Cancer - Interactions investigated in the context of cancer GST-Beta catenin and GST-ICAT have been identified as Human in origin from References 19, and 28 respectively. The same references (19,28) also refer to Human AR and Human ICAT proteins. No origin, nor any references are provided for "TCF-1", and this molecule has been deduced to be TCF-7 ( ID=P36402 for Human). zsun@stanford.edu Mol. Endocrinol. (0888-8809) 2011 Only protein-protein interactions imex curation zhuo-2011-2 The beta-catenin binding protein ICAT modulates androgen receptor activity. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Zhuo M., Zhu C., Sun J., Weis W.I., Sun Z. Cancer - Interactions investigated in the context of cancer GST-Beta catenin and GST-ICAT have been identified as Human in origin from References 19, and 28 respectively. The same references (19,28) also refer to Human AR and Human ICAT proteins. No origin, nor any references are provided for "TCF-1", and this molecule has been deduced to be TCF-7 ( ID=P36402 for Human). zsun@stanford.edu Mol. Endocrinol. (0888-8809) 2011 Only protein-protein interactions imex curation zhuo-2011-4 The beta-catenin binding protein ICAT modulates androgen receptor activity. human-lapc4 Homo sapiens LAPC4 cells derived from a human prostate cancer xenograft lapc4 Human prostate cancer xenograft cell line LAPC4 LAPC4 cells were derived from a human prostate cancer xenograft implanted in SCID mice and express wild-type androgen receptor anti bait coip anti bait coimmunoprecipitation anti bait coip western blot western blot Immuno blot Immuno blot Zhuo M., Zhu C., Sun J., Weis W.I., Sun Z. Cancer - Interactions investigated in the context of cancer GST-Beta catenin and GST-ICAT have been identified as Human in origin from References 19, and 28 respectively. The same references (19,28) also refer to Human AR and Human ICAT proteins. No origin, nor any references are provided for "TCF-1", and this molecule has been deduced to be TCF-7 ( ID=P36402 for Human). zsun@stanford.edu Mol. Endocrinol. (0888-8809) 2011 Only protein-protein interactions imex curation zhuo-2011-5 The beta-catenin binding protein ICAT modulates androgen receptor activity. human-lapc4 Homo sapiens LAPC4 cells derived from a human prostate cancer xenograft lapc4 Human prostate cancer xenograft cell line LAPC4 LAPC4 cells were derived from a human prostate cancer xenograft implanted in SCID mice and express wild-type androgen receptor ch-ip chromatin immunoprecipitation assay ch-ip primer specific pcr primer specific pcr Zhuo M., Zhu C., Sun J., Weis W.I., Sun Z. Cancer - Interactions investigated in the context of cancer GST-Beta catenin and GST-ICAT have been identified as Human in origin from References 19, and 28 respectively. The same references (19,28) also refer to Human AR and Human ICAT proteins. No origin, nor any references are provided for "TCF-1", and this molecule has been deduced to be TCF-7 ( ID=P36402 for Human). zsun@stanford.edu Mol. Endocrinol. (0888-8809) 2011 Only protein-protein interactions imex curation zhuo-2011-3 The beta-catenin binding protein ICAT modulates androgen receptor activity. human-lapc4 Homo sapiens LAPC4 cells derived from a human prostate cancer xenograft lapc4 Human prostate cancer xenograft cell line LAPC4 LAPC4 cells were derived from a human prostate cancer xenograft implanted in SCID mice and express wild-type androgen receptor anti tag coip anti tag coimmunoprecipitation anti tag coip western blot western blot Immuno blot Immuno blot Zhuo M., Zhu C., Sun J., Weis W.I., Sun Z. Cancer - Interactions investigated in the context of cancer GST-Beta catenin and GST-ICAT have been identified as Human in origin from References 19, and 28 respectively. The same references (19,28) also refer to Human AR and Human ICAT proteins. No origin, nor any references are provided for "TCF-1", and this molecule has been deduced to be TCF-7 ( ID=P36402 for Human). zsun@stanford.edu Mol. Endocrinol. (0888-8809) 2011 Only protein-protein interactions imex curation andr_human Androgen receptor Dihydrotestosterone receptor Nuclear receptor subfamily 3 group C member 4 AR DHTR NR3C4 protein protein human Homo sapiens Human MEVQLGLGRVYPRPPSKTYRGAFQNLFQSVREVIQNPGPRHPEAASAAPPGASLLLLQQQQQQQQQQQQQQQQQQQQQQQETSPRQQQQQQGEDGSPQAHRRGPTGYLVLDEEQQPSQPQSALECHPERGCVPEPGAAVAASKGLPQQLPAPPDEDDSAAPSTLSLLGPTFPGLSSCSADLKDILSEASTMQLLQQQQQEAVSEGSSSGRAREASGAPTSSKDNYLGGTSTISDNAKELCKAVSVSMGLGVEALEHLSPGEQLRGDCMYAPLLGVPPAVRPTPCAPLAECKGSLLDDSAGKSTEDTAEYSPFKGGYTKGLEGESLGCSGSAAAGSSGTLELPSTLSLYKSGALDEAAAYQSRDYYNFPLALAGPPPPPPPPHPHARIKLENPLDYGSAWAAAAAQCRYGDLASLHGAGAAGPGSGSPSAAASSSWHTLFTAEEGQLYGPCGGGGGGGGGGGGGGGGGGGGGGGEAGAVAPYGYTRPPQGLAGQESDFTAPDVWYPGGMVSRVPYPSPTCVKSEMGPWMDSYSGPYGDMRLETARDHVLPIDYYFPPQKTCLICGDEASGCHYGALTCGSCKVFFKRAAEGKQKYLCASRNDCTIDKFRRKNCPSCRLRKCYEAGMTLGARKLKKLGNLKLQEEGEASSTTSPTEETTQKLTVSHIEGYECQPIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHVDDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHLSQEFGWLQITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPTSCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGKVKPIYFHTQ ctnb1_human Catenin beta-1 Beta-catenin OK/SW-cl.35 PRO2286 CTNNB1 CTNNB protein protein human Homo sapiens Human MATQADLMELDMAMEPDRKAAVSHWQQQSYLDSGIHSGATTTAPSLSGKGNPEEEDVDTSQVLYEWEQGFSQSFTQEQVADIDGQYAMTRAQRVRAAMFPETLDEGMQIPSTQFDAAHPTNVQRLAEPSQMLKHAVVNLINYQDDAELATRAIPELTKLLNDEDQVVVNKAAVMVHQLSKKEASRHAIMRSPQMVSAIVRTMQNTNDVETARCTAGTLHNLSHHREGLLAIFKSGGIPALVKMLGSPVDSVLFYAITTLHNLLLHQEGAKMAVRLAGGLQKMVALLNKTNVKFLAITTDCLQILAYGNQESKLIILASGGPQALVNIMRTYTYEKLLWTTSRVLKVLSVCSSNKPAIVEAGGMQALGLHLTDPSQRLVQNCLWTLRNLSDAATKQEGMEGLLGTLVQLLGSDDINVVTCAAGILSNLTCNNYKNKMMVCQVGGIEALVRTVLRAGDREDITEPAICALRHLTSRHQEAEMAQNAVRLHYGLPVVVKLLHPPSHWPLIKATVGLIRNLALCPANHAPLREQGAIPRLVQLLVRAHQDTQRRTSMGGTQQQFVEGVRMEEIVEGCTGALHILARDVHNRIVIRGLNTIPLFVQLLYSPIENIQRVAAGVLCELAQDKEAAEAIEAEGATAPLTELLHSRNEGVATYAAAVLFRMSEDKPQDYKKRLSVELTSSLFRTEPMAWNETADLGLDIGAQGEPLGYRQDDPSYRSFHSGGYGQDALGMDPMMEHEMGGHHPGADYPVDGLPDLGHAQDLMDGLPPGDSNQLAWFDTDL cnbp1_human Beta-catenin-interacting protein 1 Inhibitor of beta-catenin and Tcf-4 CTNNBIP1 ICAT protein protein human Homo sapiens Human MNREGAPGKSPEEMYIQQKVRVLLMLRKMGSNLTASEEEFLRTYAGVVNSQLSQLPPHSIDQGAEDVVMAFSRSETEDRRQ klk3_human_gene Human kallikrein-related peptidase 3 (KLK3) (PSA) gene gene human Homo sapiens Human ctnnb1-ar-1 1291346 n/a 1291351 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291352 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false direct interaction direct interaction false false false Fig 5B ctnnb1-ar-1 1291346 n/a 1291352 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291351 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro n/a 1291353 unspecified role unspecified role prey prey region 35s radiolabel 35s radiolabel 35S s35 radiolabelled S35 s35 radiolabelled 35S S35 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false in vitro In vitro association association false false false Fig 5B ctnnb1-ar-1 1291347 n/a 1291353 unspecified role unspecified role ancillary ancillary n_terminal region sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false n/a 1291351 unspecified role unspecified role prey prey human-lapc4 Homo sapiens LAPC4 cells derived from a human prostate cancer xenograft lapc4 Human prostate cancer xenograft cell line LAPC4 LAPC4 cells were derived from a human prostate cancer xenograft implanted in SCID mice and express wild-type androgen receptor n/a 1291352 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 5C Truncated ICAT ( N-terminal region) showed greater GST-beta catenin binding to AR, than full length ICAT. ctnnbip1-ar-4 1291347 n/a 1291351 unspecified role unspecified role prey prey human-lapc4 Homo sapiens LAPC4 cells derived from a human prostate cancer xenograft lapc4 Human prostate cancer xenograft cell line LAPC4 LAPC4 cells were derived from a human prostate cancer xenograft implanted in SCID mice and express wild-type androgen receptor n/a 1291352 unspecified role unspecified role ancillary ancillary n/a 1291353 unspecified role unspecified role bait bait region gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 5D Direct binding between ICAT and AR proteins was not detected when beta-catenin was absent. ctnnbip1-ar-3 1291348 n/a 1291351 unspecified role unspecified role prey prey n/a 1291352 unspecified role unspecified role prey prey n/a 1291353 unspecified role unspecified role bait bait association association false false false Fig 6 ar-ctnnb1-4 1291348 n/a 1291351 unspecified role unspecified role bait bait n/a 1291353 unspecified role unspecified role prey prey n/a 1291352 unspecified role unspecified role prey prey association association false false false Fig 6 ar-klk3-1 1291349 n/a 1291354 unspecified role unspecified role prey prey are_promoter_region (-164 to -406 from tss) binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false are_promoter_region (-3978 to -4170 from tss) binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false are_promoter_region (-39 to -250 from tss) binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291351 unspecified role unspecified role bait bait association association false false false Fig 6E DHT icat-klk3 1291349 n/a 1291353 unspecified role unspecified role bait bait n/a 1291354 unspecified role unspecified role prey prey are_promoter_region (-164 to -406 from tss) binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false are_promoter_region (-3978 to -4170 from tss) binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false are_promoter_region (-39 to -250 from tss) binding region binding-associated region binding region undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false association association false false false Fig 6E DHT ctnnbip1-ar-2 1291350 n/a 1291351 unspecified role unspecified role prey prey n/a 1291353 unspecified role unspecified role bait bait region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false n/a 1291352 unspecified role unspecified role prey prey association association false false false Fig 5E