IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ devarenne-2011-2 The plant cell death suppressor Adi3 interacts with the autophagic protein Atg8h. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Devarenne T.P. tpd8@tamu.edu Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation devarenne-2011-1 The plant cell death suppressor Adi3 interacts with the autophagic protein Atg8h. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid nucleotide sequence nucleotide sequence identification sequence cloning sequence cloning nucleotide sequence Devarenne T.P. tpd8@tamu.edu cDNA prey library developed from Pst (Pseudomonas syringae pv. tomato) exposed tomato leaves. Biochem. Biophys. Res. Commun. (0006-291X) 2011 Only protein-protein interactions imex curation q5i6e9_sollc Adi3 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MERIPEVRESTRQFPIGAKVAHTFSTSKKEVGIRGFRDFDLAIPIQTWKGKTSYQEEEDLMVDAGTIKRSDDSLEDSGSTSFHGASHPPEPVDTDLMRPVYVPIGQNKADGKCLVKNVSLKGPFLDDLSIRMPNVKPSPSLLSPAESLVEEPNDLGVISSPFTVPRPSQNTETSLPPDSEEKECIWDASLPPSGNVSPLSSIDSTGVVRSMSIVNSCTSTYRSDVLMSDGMLSVDRNYESTKGSIRGDSLESGKTSLSRASDSSGLSDDSNWSNITGSANKPHKGNDPRWKAILAIRARDGILGMSHFKLLKRLGCGDIGSVYLSELSGTRCYFAMKVMDKASLASRKKLTRAQTEREILQLLDHPFLPTLYTHFETDRFSCLVMEYCPGGDLHTLRQRQPGKHFSEYAARFYAAEVLLALEYLHMLGVVYRDLKPENVLVRDDGHIMLSDFDLSLRCAVSPTLIRISSDDPSKRGAAFCVQPACIEPTTVCMQPACFLPRLFPQKSKKKTPKPRADSGFQANSMPELVAEPTSARSMSFVGTHEYLAPEIIKGEGHGSAVDWWTFGIFLHELLYGKTPFKGSGNRATLFNVVGQQLKFPDSPATSYASRDLIRGLLVKEPQNRLGVKRGATEIKQHPFFEGVNWALIRCSTPPEVPRPVEPDYPAKYGQVNPVGVGNTSKRVVGADAKSGGKYLDFEFF f2yhl2_sollc Autophagy-related protein protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MGKTFKDEYSYDERLTESQDIIAKYPDRVPVVAERYSKTDLPEMEKKKYLVPRDMSVGQFIHILSGRLHLAPGKALFVFVNNTLPQTTSLIETVYESSKDKDGFLYMCYSSEKTFGGHS f1jyz5_sollc Autophagy-related protein 100736468 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MAKSSFKLEHPLERRQAEAARIREKYPDRIPVIVEKAERSDIPDIDKKKYLVPADLTVGQFVYVVRKRIKLSAEKAIFIFVKNILPPTAAMMSAIYEEHKDEDGFLYMTYSGENTFGSF f1jyz6_sollc Autophagy-related protein 100736469 protein protein sollc Solanum lycopersicum (Tomato) Lycopersicon esculentum Tomato MAKSSFKQEHDLEKRRAEAARIREKYADRIPVIVEKAEKSDIPNIDKKKYLVPADLTVGQFVYVIRKRIKLSAEKAIFIFIDNVLPPTGAIMSAIYDEKKDDDGFLYVTYSGENTFGVLSEL adi3-f2yhl2-1 1275598 n/a 1275600 unspecified role unspecified role bait bait n/a 1275601 unspecified role unspecified role prey prey physical association physical association false false false 2a adi3-f2yhl2-2 1275598 n/a 1275600 unspecified role unspecified role prey prey n/a 1275601 unspecified role unspecified role bait bait physical association physical association false false false 2a and 2b f1jyz5-adi3 1275598 n/a 1275602 unspecified role unspecified role bait bait n/a 1275600 unspecified role unspecified role prey prey physical association physical association false false false 2b f1jyz6-adi3-1 1275598 n/a 1275603 unspecified role unspecified role bait bait n/a 1275600 unspecified role unspecified role prey prey physical association physical association false false false 2b adi3-f2yhl2 1275599 n/a 1275601 unspecified role unspecified role prey prey n/a 1275600 unspecified role unspecified role bait bait physical association physical association false false false text, section 3.1