mpidb The Microbial Protein Interaction Database roncarati-2011-1 CbpA acts as a modulator of HspR repressor DNA binding activity in Helicobacter pylori. helpy Helicobacter pylori Campylobacter pylori pull down pull down anti tag western anti tag western blot anti tag western Roncarati D., Danielli A., Scarlato V. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation roncarati-2011-2 CbpA acts as a modulator of HspR repressor DNA binding activity in Helicobacter pylori. helpy Helicobacter pylori Campylobacter pylori pull down pull down western blot western blot Immuno blot Immuno blot Roncarati D., Danielli A., Scarlato V. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation o25668_helpy HP_1024 protein protein helpy Helicobacter pylori Campylobacter pylori MSKSLYQTLNVSENASQDEIKKSYRRLARQYHPDLNKTKEAEEKFKEINAAYEILSDEEKRRQYDQFGDNMFGGQNFSDFARSRGPSEDLDDILSSIFGKGGFSQRFSQNSQGFSGFNFSNFAPENLDITAALNVSVLDTLLGNKKQVSINNETFSLKIPIGVEEGEKIRVRNKGKTGRTTRGDLLLEIHIEEDEMYRREKDDITQIFDLPLKTALFGGKIEIATWHKTLTLTIPPNTKAMQKFRIKEKGIKNRKTSHVGDLYLQARLILPKTETLSNELKALLEKEL o25669_helpy HP_1025 protein protein helpy Helicobacter pylori Campylobacter pylori MCDYDEPLYLISVVAKILGVHPQTLRQYEKEGLIEPSRTDGKMRLYSQRDMDKIKTILRLTRDMGVNLAGVDIILRLKEKLDELDNLNKELQDALHKHSKNTKTPTKNLNTPTNFYELILFKK o25669-o25668 1338922 not-defined-1976625303 1338924 unspecified role unspecified role prey prey o25668-- O25668-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-544687002 1338925 unspecified role unspecified role bait bait o25669-- O25669-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false figure 3A o25669-o25668-1 1338923 not-defined-544687002 1338925 unspecified role unspecified role bait bait o25669-- O25669-- gst tag glutathione s tranferase tag glutathione S-tranferase tag glutathione S-tranferase tag gst tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1976625303 1338924 unspecified role unspecified role prey prey physical association physical association false false false figure 3A