mpidb The Microbial Protein Interaction Database hart-2011-1 Recognition of DNA by the helix-turn-helix global regulatory protein Lrp is modulated by the amino terminus. ecolx Escherichia coli dls dynamic light scattering dls predetermined predetermined participant predetermined Hart B.R., Mishra P.K., Lintner R.E., Hinerman J.M., Herr A.B., Blumenthal R.M. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation hart-2011-2 Recognition of DNA by the helix-turn-helix global regulatory protein Lrp is modulated by the amino terminus. ecolx Escherichia coli solution sedimentati cosedimentation in solution solution sedimentati predetermined predetermined participant predetermined Hart B.R., Mishra P.K., Lintner R.E., Hinerman J.M., Herr A.B., Blumenthal R.M. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation o05140_promi lrp lrp_1 AM402_15495 CEP63_001145 NCTC10975_00505 NCTC11938_01150 E4V60_15205 E4V43_08085 GO498_06800 protein protein proteus mirabilis Proteus mirabilis MIDNKKRPGKDLDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFISGYTALLNPHYLDASLLVFVEITLNRGAPDVFEQFNMAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLGETLLRLPGVNDTRTYVVMEEVKQSNRLVIKTR lrp_ecoli Leucine-responsive regulatory protein lrp alsB ihb livR oppI b0889 JW0872 protein protein ecoli Escherichia coli (strain K12) MVDSKKRPGKDLDRIDRNILNELQKDGRISNVELSKRVGLSPTPCLERVRRLERQGFIQGYTALLNPHYLDASLLVFVEITLNRGAPDVFEQFNTAVQKLEEIQECHLVSGDFDYLLKTRVPDMSAYRKLLGETLLRLPGVNDTRTYVVMEEVKQSNRLVIKTR lrp-lrp-2 1338640 not-defined-627137403 1338642 unspecified role unspecified role unspecified role unspecified role Stoichiometry: 8.0 physical association physical association false false false figure 6 Forms octamers in the presence of leucine, hexadecamers in its absence. lrp-lrp-4 1338640 not-defined-1278780343 1338643 unspecified role unspecified role neutral component neutral component Stoichiometry: 8.0 physical association physical association false false false figure 6 lrp-lrp 1338641 not-defined-164486129 1338642 unspecified role unspecified role unspecified role unspecified role not-defined-520643869 1338642 unspecified role unspecified role unspecified role unspecified role physical association physical association false false false figure 7 lrp-lrp-1 1338641 not-defined-325626564 1338643 unspecified role unspecified role unspecified role unspecified role P0ACJ0:p.[Val2Ile;Ser4Asn] P0ACJ0-2-4 mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false not-defined-321175157 1338643 unspecified role unspecified role unspecified role unspecified role P0ACJ0:p.[Val2Ile;Ser4Asn] P0ACJ0-2-4 mutation mutation certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 7