mpidb The Microbial Protein Interaction Database rahn_lee-2011-1 The sporulation protein SirA inhibits the binding of DnaA to the origin of replication by contacting a patch of clustered amino acids. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Rahn-Lee L., Merrikh H., Grossman A.D., Losick R. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation dnaa_bacsu Chromosomal replication initiator protein DnaA dnaA dnaH BSU00010 protein protein bacsu Bacillus subtilis MENILDLWNQALAQIEKKLSKPSFETWMKSTKAHSLQGDTLTITAPNEFARDWLESRYLHLIADTIYELTGEELSIKFVIPQNQDVEDFMPKPQVKKAVKEDTSDFPQNMLNPKYTFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAIGHYVIDHNPSAKVVYLSSEKFTNEFINSIRDNKAVDFRNRYRNVDVLLIDDIQFLAGKEQTQEEFFHTFNTLHEESKQIVISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRIAILRKKAKAEGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLINKDINADLAAEALKDIIPSSKPKVITIKEIQRVVGQQFNIKLEDFKAKKRTKSVAFPRQIAMYLSREMTDSSLPKIGEEFGGRDHTTVIHAHEKISKLLADDEQLQQHVKEIKEQLK sira_bacsu Sporulation inhibitor of replication protein SirA sirA yneE yoxF BSU17900 protein protein bacsu Bacillus subtilis MERHYYTYLIKEEFANHYFGRESVMFELFQDYHWTSLEKQQYEMTEKQIQYITQPIPILHMHQRLKMNLNKTDYRQLDYIYRIALPKAKGHATFMMKEHMIEIVASGDYEAETIFFEVLRKVSPCFLAMDFNSKRYGWLNPVKERNFV dnaa-sira-1 1338217 not-defined-2119717932 1338218 unspecified role unspecified role bait bait P05648:p.Phe49Tyr P05648-49-49 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P05648:p.Ala50Val P05648-110-446 mutation mutation certain certain sequence position certain certain certain sequence position certain false region P05648-81-446 sufficient to bind sufficient binding region sufficient to bind certain certain sequence position certain certain certain sequence position certain false P05648:p.Asn47Asp P05648-47-47 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false P05648:p.Ala50Thr P05648-50-50 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false not-defined-1734358233 1338219 unspecified role unspecified role prey prey physical association physical association false false false table 3; figure 3