mpidb The Microbial Protein Interaction Database sperandeo-2011-1 New insights into the Lpt machinery for lipopolysaccharide transport to the cell surface: LptA-LptC interaction and LptA stability as sensors of a properly assembled transenvelope complex. ecoli Escherichia coli (strain K12) pull down pull down western blot western blot Immuno blot Immuno blot Sperandeo P., Villa R., Martorana A.M., Samalikova M., Grandori R., Deho G., Polissi A. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation sperandeo-2011-3 New insights into the Lpt machinery for lipopolysaccharide transport to the cell surface: LptA-LptC interaction and LptA stability as sensors of a properly assembled transenvelope complex. ecoli Escherichia coli (strain K12) crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Sperandeo P., Villa R., Martorana A.M., Samalikova M., Grandori R., Deho G., Polissi A. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation sperandeo-2011-2 New insights into the Lpt machinery for lipopolysaccharide transport to the cell surface: LptA-LptC interaction and LptA stability as sensors of a properly assembled transenvelope complex. in vitro In vitro crosslink cross-linking study crosslink western blot western blot Immuno blot Immuno blot Sperandeo P., Villa R., Martorana A.M., Samalikova M., Grandori R., Deho G., Polissi A. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation sperandeo-2011-4 New insights into the Lpt machinery for lipopolysaccharide transport to the cell surface: LptA-LptC interaction and LptA stability as sensors of a properly assembled transenvelope complex. ecolx Escherichia coli molecular sieving molecular sieving Gel Filtration Size Exclusion Chromatography Size Exclusion Chromatography Gel Filtration Sizing column predetermined predetermined participant predetermined Sperandeo P., Villa R., Martorana A.M., Samalikova M., Grandori R., Deho G., Polissi A. J. Bacteriol. (0021-9193) 2011 Only protein-protein interactions imex curation lpta_ecoli Lipopolysaccharide export system protein LptA lptA b3200 JW3167 yhbN protein protein ecoli Escherichia coli (strain K12) MKFKTNKLSLNLVLASSLLAASIPAFAVTGDTDQPIHIESDQQSLDMQGNVVTFTGNVIVTQGTIKINADKVVVTRPGGEQGKEVIDGYGKPATFYQMQDNGKPVEGHASQMHYELAKDFVVLTGNAYLQQVDSNIKGDKITYLVKEQKMQAFSDKGKRVTTVLVPSQLQDKNNKGQTPAQKKGN lptc_ecoli Lipopolysaccharide export system protein LptC lptC b3199 JW3166 yrbK protein protein ecoli Escherichia coli (strain K12) MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQTQP lptc-lpta 1338117 not-defined-108624439 1338121 unspecified role unspecified role prey prey not-defined-1887961099 1338122 unspecified role unspecified role bait bait p0adv9-177-191 P0ADV9-177-191 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false P0ADV9:p.Gly153Arg P0ADV9-153-153 mutation disrupting mutation disrupting interaction mutation disrupting certain certain sequence position certain certain certain sequence position certain false c-terminal his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false figure 1, 4 lptc-lpta-1 1338117 not-defined-1612200841 1338122 unspecified role unspecified role bait bait p0adv9-- P0ADV9-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1523553077 1338121 unspecified role unspecified role prey prey physical association physical association false false false figure 1 lptc-lptc-1 1338118 not-defined-1079689049 1338122 unspecified role unspecified role prey prey p0adv9-- P0ADV9-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-1102750437 1338122 unspecified role unspecified role bait bait p0adv9-- P0ADV9-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 6 lptc-lptc-5 1338118 not-defined-2030612226 1338122 unspecified role unspecified role neutral component neutral component not-defined-533720580 1338122 unspecified role unspecified role neutral component neutral component physical association physical association false false false Figure 6 lptc-lptc 1338119 not-defined-345042923 1338122 unspecified role unspecified role prey prey ecolx Escherichia coli not-defined-555384172 1338122 unspecified role unspecified role bait bait ecolx Escherichia coli physical association physical association false false false Figure 1b lptc-lptc-4 1338120 not-defined-1170105716 1338122 unspecified role unspecified role neutral component neutral component p0adv9-- P0ADV9-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-132650771 1338122 unspecified role unspecified role neutral component neutral component p0adv9-- P0ADV9-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Figure 8