mpidb The Microbial Protein Interaction Database gerken-2010-1 MzrA-EnvZ interactions in the periplasm influence the EnvZ/OmpR two-component regulon. ecolx Escherichia coli adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Gerken H, Misra R J. Bacteriol. (ISSN:0021-9193) 2010 Only protein-protein interactions imex curation envz_ecoli Sensor histidine kinase EnvZ Osmolarity sensor protein EnvZ envZ ompB perA tpo b3404 JW3367 protein protein ecoli Escherichia coli (strain K12) MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKEG mzra_ecoli Modulator protein MzrA mzrA ecfM yqjB JW3067 b3096 protein protein ecoli Escherichia coli (strain K12) MQIPRMSLRQLAWSGAVLLLVGTLLLAWSAVRQQESTLAIRAVHQGTTMPDGFSIWHHLDAHGIPFKSITPKNDTLLITFDSSDQSAAAKAVLDRTLPHGYIIAQQDNNSQAMQWLTRLRDNSHRFG mzra-envz 1337857 not-defined-347868969 1337858 unspecified role unspecified role prey prey not-defined-426424105 1337859 unspecified role unspecified role bait bait P42615:p.Ile78Phe P42615-78-78 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P42615:p.Asp51Ala P42615-51-51 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P42615:p.[Asp51Ala;Ile78Phe] P42615-51-78 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false figure 7 mzra-mzra 1337857 not-defined-1076339089 1337859 unspecified role unspecified role prey prey P42615:p.[Asp51Ala;Ile78Phe] P42615-51-78 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false P42615:p.Ile78Phe P42615-78-78 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false P42615:p.Asp51Ala P42615-51-51 mutation decreasing mutation decreasing interaction hotspot hotspot mutation decreasing certain certain sequence position certain certain certain sequence position certain false not-defined-10366426 1337859 unspecified role unspecified role bait bait physical association physical association false false false figure 7