mpidb The Microbial Protein Interaction Database yun-2010-1 Pmr, a histone-like protein H1 (H-NS) family protein encoded by the IncP-7 plasmid pCAR1, is a key global regulator that alters host function. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Yun C.S., Suzuki C., Naito K., Takeda T., Takahashi Y., Sai F., Terabayashi T., Miyakoshi M., Shintani M., Nishida H., Yamane H., Nojiri H. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation q88rw2_psepk PP_0017 protein protein psepk psepk MSRLAEFRLLEQQLAAQLAELEALKNDSALKQEMEFETKLRSLLNEYGYGLRQVVLILDPQAVASTDMAPKTSRKPREVKVYKNPHSGEVVETKGGNQRTLKAWKNEYGAEVVESWLAN q88n50_psepk PP_1366 protein protein psepk psepk MSLINEYRATEEAIKELQARLANLSQDDKLKKELEFEGKLRTLMGEYSKSLRDVIALLDPESKLSKAPRGSVKTTVTKRARKVKQYKNPHNGEVIETKGGNHKTLKEWKATWGGDVVESWATLLD q88iq2_psepk PP_2947 protein protein psepk psepk MHMSRLAEFRQLEQKLAAQLAELEAMKSSGELQKEIEFETKLRDLLSKYGYSLRDIINILDPQASRRSAAPAATEKAPRRARQVKQYKNPHNGEVIETKGGNHKLLKEWKAQYGAEEVESWVS q88gf9_psepk PP_3765 protein protein psepk psepk MSRLAEFRAAEKALQEQMAQLEALKKDAGLKREIEFEQKLVGLMKSYDKSLRDIIAILDPKAVARASSTPPKQQRRPRVVKVYQNPHTGERIETKGGNHRGLKAWKEQYGAATVESWVR q88rw2-q88rw2 1337628 n/a 1337629 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli n/a 1337629 unspecified role unspecified role prey prey region flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false figure 2B q88rw2-q88n60 1337628 n/a 1337629 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-424002861 1337630 unspecified role unspecified role prey prey region Q88N50-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false figure 2B q88rw2-q88iq2 1337628 n/a 1337629 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-2097971370 1337631 unspecified role unspecified role prey prey q88iq2-- Q88IQ2-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false figure 2B q88rw2-q88gf9 1337628 n/a 1337629 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-238988188 1337632 unspecified role unspecified role prey prey q88gf9-- Q88GF9-- flag tag flag tag FLAG-tagged FLAG DYKDDDDKV epitope tag DYKDDDDKV epitope tag FLAG FLAG-tagged undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli physical association physical association false false false figure 2B