mpidb The Microbial Protein Interaction Database isticato-2010-1 CotE binds to CotC and CotU and mediates their interaction during spore coat formation in Bacillus subtilis. in vitro In vitro pull down pull down western blot western blot Immuno blot Immuno blot Isticato R., Pelosi A., De Felice M., Ricca E. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation isticato-2010-2 CotE binds to CotC and CotU and mediates their interaction during spore coat formation in Bacillus subtilis. ecolx Escherichia coli comigration in gel comigration in gel electrophoresis comigration in gel sequence tag sequence tag identification sequence tag Isticato R., Pelosi A., De Felice M., Ricca E. J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation ynzh_bacsu Uncharacterized protein YnzH ynzH BSU17670 protein protein bacsu Bacillus subtilis MGYYKKYKEEYYTWKKTYYKKYYDNDKKHYDCDKYYDHDKKHYDYDKKYDDHDKKYYDDHDYHYEKKYYDDDDHYYDFVESYKKHH cote_bacsu Spore coat protein E cotE BSU17030 protein protein bacsu Bacillus subtilis MSEYREIITKAVVAKGRKFTQCTNTISPEKKPSSILGGWIINHKYDAEKIGKTVEIEGYYDINVWYSYADNTKTEVVTERVKYVDVIKLRYRDNNYLDDEHEVIAKVLQQPNCLEVTISPNGNKIVVQAEREFLAEVVGETKVVVEVNPDWEEDDEEDWEDELDEELEDINPEFLVGDPEE cotc_bacsu Spore coat protein C cotC BSU17700 protein protein bacsu Bacillus subtilis MGYYKKYKEEYYTVKKTYYKKYYEYDKKDYDCDYDKKYDDYDKKYYDHDKKDYDYVVEYKKHKKHY ynzh-cote 1336982 n/a 1336984 unspecified role unspecified role bait bait region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli not-defined-147232781 1336985 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false Fig. 2B cotc-cote 1336982 not-defined-1924859156 1336985 unspecified role unspecified role prey prey not-defined-1466145998 1336986 unspecified role unspecified role bait bait p07790-- P07790-- his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false physical association physical association false false false Fig. 2A cotc-ynzh-1 1336983 n/a 1336984 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli not-defined-1055301034 1336986 unspecified role unspecified role neutral component neutral component ecolx Escherichia coli physical association physical association false false false Fig. 3A cotc-cotc-2 1336983 not-defined-927725418 1336986 unspecified role unspecified role unspecified role unspecified role not-defined-1005927320 1336986 unspecified role unspecified role unspecified role unspecified role physical association physical association false false false Fig. 3A