mpidb The Microbial Protein Interaction Database tanaka-2010-1 Functional analysis of the stability determinant AlfB of pBET131, a miniplasmid derivative of bacillus subtilis (natto) plasmid pLS32. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Tanaka T. teruot@scc.u-tokai.ac.jp J. Bacteriol. (0021-9193) 2010 Only protein-protein interactions imex curation e9rjg4_bacna alfA protein protein bacillus subtilis su Bacillus subtilis subsp. natto MTLTTVIDIGNFSTKYAYKDKKQIKVGSFPSILHSYKPLEDYEGMERVEYNGLDYYVGETVKNFYFGREEQMYFGNTRKGHMEGQIRLVYALYTIFKETGKKEFNLILTCPYESMVTDKKYFVQHFEGEREVIVEGKSFKFTVHNIVMAAEGLGALNFSDSLNCVIVDAGSKTLNVLYLINGSISKMDSHTINGGTIDNSIMDLAKTFAKTCSNIDYDYPIVCTGGKAEEMKECLENVGYSTVSSAELGEDKPSYYVNSVGLLLKYGRKFEEMFA e9rjg5_bacna alfB protein protein bacillus subtilis su Bacillus subtilis subsp. natto MSREDNFMYQINWNKKKYPEICKALEDAKNRTGGIAWYLRELIQKDLEEKRGGVVRSTPVYETVDQEVQNDPPKPSKAKIETIELPDDSGGFL alfa-alfb 1336902 not-defined-537060102 1336903 unspecified role unspecified role bait bait not-defined-103486365 1336904 unspecified role unspecified role prey prey physical association physical association false false false Fig. 8A alfb-alfb 1336902 not-defined-2006592470 1336904 unspecified role unspecified role prey prey not-defined-1039883258 1336904 unspecified role unspecified role bait bait physical association physical association false false false Fig. 8B alfa-alfa 1336902 not-defined-661989180 1336903 unspecified role unspecified role prey prey not-defined-802640356 1336903 unspecified role unspecified role bait bait physical association physical association false false false Fig. 8B