UniProt UniProt http://www.uniprot.org chen-2009-2 GDI-1 preferably interacts with Rab10 in insulin-stimulated GLUT4 translocation. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. anti tag coip anti tag coimmunoprecipitation anti tag coip anti tag western anti tag western blot anti tag western Chen Y., Deng Y., Zhang J., Yang L., Xie X., Xu T. Origin of human Rab4 and murine Rab10 cDNAs is assumed from the acknowledgements. xutao@ibp.ac.cn Biochem. J. (0264-6021) 2009 mimix curation chen-2009-3 GDI-1 preferably interacts with Rab10 in insulin-stimulated GLUT4 translocation. human-293 Homo sapiens transformed primary embryonal kidney cells Human 293 Transformed human primary embryonal kidney cells. The Cell type named 293 is synonymous with HEK-293. fret fluorescent resonance energy transfer FRET RET FRET analysis FRET RET FRET analysis fret predetermined predetermined participant predetermined Chen Y., Deng Y., Zhang J., Yang L., Xie X., Xu T. Origin of human Rab4 and murine Rab10 cDNAs is assumed from the acknowledgements. xutao@ibp.ac.cn Biochem. J. (0264-6021) 2009 mimix curation chen-2009-1 GDI-1 preferably interacts with Rab10 in insulin-stimulated GLUT4 translocation. mouse-3t3_l1 Mus musculus embryonic cells Fibroblast-like. Adipose like when confluent 3t3_l1 Mouse embryo cells Fibroblast-like. Adipose like when confluent confocal microscopy confocal microscopy tag fluorescence tag visualisation by fluorescence tag fluorescence Chen Y., Deng Y., Zhang J., Yang L., Xie X., Xu T. Origin of human Rab4 and murine Rab10 cDNAs is assumed from the acknowledgements. xutao@ibp.ac.cn Biochem. J. (0264-6021) 2009 mimix curation gdia_human Rab GDP dissociation inhibitor alpha GDI1 OPHN2 RABGDIA XAP4 Guanosine diphosphate dissociation inhibitor 1 Oligophrenin-2 Protein XAP-4 GDIL protein protein human Homo sapiens Human MDEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESSSITPLEELYKRFQLLEGPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVVEGSFVYKGGKIYKVPSTETEALASNLMGMFEKRRFRKFLVFVANFDENDPKTFEGVDPQTTSMRDVYRKFDLGQDVIDFTGHALALYRTDDYLDQPCLETVNRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPVDDIIMENGKVVGVKSEGEVARCKQLICDPSYIPDRVRKAGQVIRIICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISYAHNVAAQGKYIAIASTTVETTDPEKEVEPALELLEPIDQKFVAISDLYEPIDDGCESQVFCSCSYDATTHFETTCNDIKDIYKRMAGTAFDFENMKRKQNDVFGEAEQ rab10_mouse Ras-related protein Rab-10 Rab10 protein protein mouse Mus musculus Mouse MAKKTYDLLFKLLLIGDSGVGKTCVLFRFSDDAFNTTFISTIGIDFKIKTVELQGKKIKLQIWDTAGQERFHTITTSYYRGAMGIMLVYDITNGKSFENISKWLRNIDEHANEDVERMLLGNKCDMDDKRVVPKGKGEQIAREHGIRFFETSAKANINIEKAFLTLAEDILRKTPVKEPNSENVDISSGGGVTGWKSKCC gdib_human Rab GDP dissociation inhibitor beta Guanosine diphosphate dissociation inhibitor 2 GDI2 RABGDIB protein protein human Homo sapiens Human MNEEYDVIVLGTGLTECILSGIMSVNGKKVLHMDRNPYYGGESASITPLEDLYKRFKIPGSPPESMGRGRDWNVDLIPKFLMANGQLVKMLLYTEVTRYLDFKVTEGSFVYKGGKIYKVPSTEAEALASSLMGLFEKRRFRKFLVYVANFDEKDPRTFEGIDPKKTTMRDVYKKFDLGQDVIDFTGHALALYRTDDYLDQPCYETINRIKLYSESLARYGKSPYLYPLYGLGELPQGFARLSAIYGGTYMLNKPIEEIIVQNGKVIGVKSEGEIARCKQLICDPSYVKDRVEKVGQVIRVICILSHPIKNTNDANSCQIIIPQNQVNRKSDIYVCMISFAHNVAAQGKYIAIVSTTVETKEPEKEIRPALELLEPIEQKFVSISDLLVPKDLGTESQIFISRTYDATTHFETTCDDIKNIYKRMTGSEFDFEEMKRKKNDIYGED rab4a_human Ras-related protein Rab-4A RAB4A RAB4 protein protein human Homo sapiens Human MSQTAMSETYDFLFKFLVIGNAGTGKSCLLHQFIEKKFKDDSNHTIGVEFGSKIINVGGKYVKLQIWDTAGQERFRSVTRSYYRGAAGALLVYDITSRETYNALTNWLTDARMLASQNIVIILCGNKKDLDADREVTFLEASRFAQENELMFLETSALTGENVEEAFVQCARKILNKIESGELDPERMGSGIQYGDAALRQLRSPRRAQAPNAQECGC rab10-gdi1-1 1320891 n/a 1320894 unspecified role unspecified role prey prey n/a 1320895 unspecified role unspecified role bait bait physical association physical association false false false Fig 4 rab10-gdi2-1 1320891 n/a 1320895 unspecified role unspecified role bait bait n/a 1320896 unspecified role unspecified role prey prey physical association physical association false false false Fig 4 gdi1-rab4a 1320891 n/a 1320897 unspecified role unspecified role bait bait n/a 1320894 unspecified role unspecified role prey prey physical association physical association false false false Fig 7A rab4a-gdi2 1320891 n/a 1320896 unspecified role unspecified role prey prey n/a 1320897 unspecified role unspecified role bait bait physical association physical association false false false Fig 7A gdi1-rab10 1320892 n/a 1320895 unspecified role unspecified role neutral component neutral component gfp egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1320894 unspecified role unspecified role neutral component neutral component mko kusabira-green kusabira-green protein tag kusabira-green n-term range n-terminal range n-term range n-term range n-terminal range n-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Fig 5 gdi2-rab10 1320892 n/a 1320895 unspecified role unspecified role neutral component neutral component gfp egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1320896 unspecified role unspecified role neutral component neutral component mkotag kusabira-green kusabira-green protein tag kusabira-green n-term range n-terminal range n-term range n-term range n-terminal range n-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Fig5 gdi1-rab4a-1 1320892 n/a 1320897 unspecified role unspecified role neutral component neutral component mkorab4 kusabira-green kusabira-green protein tag kusabira-green n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1320894 unspecified role unspecified role neutral component neutral component egfpgdi1 egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Fig 7B gdi2-rab4a 1320892 n/a 1320897 unspecified role unspecified role neutral component neutral component mkorab4 kusabira-green kusabira-green protein tag kusabira-green n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1320896 unspecified role unspecified role neutral component neutral component egfpgdi1 egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false proximity proximity close-contact colocalization neighbourhood interaction false false false Fig 7B rab10-gdi1 1320893 n/a 1320894 unspecified role unspecified role neutral component neutral component mko kusabira-green kusabira-green protein tag kusabira-green n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1320895 unspecified role unspecified role neutral component neutral component gfp egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig 2B rab10-gdi2 1320893 n/a 1320895 unspecified role unspecified role neutral component neutral component gfp egfp tag enhanced green fluorescent protein tag enhanced green fluorescent protein EGFP enhanced green fluorescent protein EGFP egfp tag n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1320896 unspecified role unspecified role neutral component neutral component mkotag kusabira-green kusabira-green protein tag kusabira-green n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Fig 2C