IntAct European Bioinformatics Institute IntAct intact http://www.ebi.ac.uk/ http://www.ebi.ac.uk/intact/query/${ac} EBI-[0-9]+|IA:[0-9]+ INTerAction database (IntAct) provides an open source database and toolkit for the storage, presentation and analysis of molecular interactions. http://www.ebi.ac.uk/intact European Bioinformatics Institute; Wellcome Trust Genome Campus; Hinxton, Cambridge; CB10 1SD; United Kingdom http://www.ebi.ac.uk/intact/ http://www.ebi.ac.uk/ gerken-2009-1 MzrA: a novel modulator of the EnvZ/OmpR two-component regulon. ecoli Escherichia coli (strain K12) adenylate cyclase adenylate cyclase complementation bacterial two-hybrid bacterial two-hybrid adenylate cyclase predetermined predetermined participant predetermined Gerken H., Charlson E.S., Cicirelli E.M., Kenney L.J., Misra R. rajeev.misra@ asu.edu rajeev.misra@asu.edu Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation envz_ecoli Sensor histidine kinase EnvZ Osmolarity sensor protein EnvZ envZ ompB perA tpo b3404 JW3367 protein protein ecoli Escherichia coli (strain K12) MRRLRFSPRSSFARTLLLIVTLLFASLVTTYLVVLNFAILPSLQQFNKVLAYEVRMLMTDKLQLEDGTQLVVPPAFRREIYRELGISLYSNEAAEEAGLRWAQHYEFLSHQMAQQLGGPTEVRVEVNKSSPVVWLKTWLSPNIWVRVPLTEIHQGDFSPLFRYTLAIMLLAIGGAWLFIRIQNRPLVDLEHAALQVGKGIIPPPLREYGASEVRSVTRAFNHMAAGVKQLADDRTLLMAGVSHDLRTPLTRIRLATEMMSEQDGYLAESINKDIEECNAIIEQFIDYLRTGQEMPMEMADLNAVLGEVIAAESGYEREIETALYPGSIEVKMHPLSIKRAVANMVVNAARYGNGWIKVSSGTEPNRAWFQVEDDGPGIAPEQRKHLFQPFVRGDSARTISGTGLGLAIVQRIVDNHNGMLELGTSERGGLSIRAWLPVPVTRAQGTTKEG mzra_ecoli Modulator protein MzrA mzrA ecfM yqjB JW3067 b3096 protein protein ecoli Escherichia coli (strain K12) MQIPRMSLRQLAWSGAVLLLVGTLLLAWSAVRQQESTLAIRAVHQGTTMPDGFSIWHHLDAHGIPFKSITPKNDTLLITFDSSDQSAAAKAVLDRTLPHGYIIAQQDNNSQAMQWLTRLRDNSHRFG mzra-envz-1 1343967 n/a 1343968 unspecified role unspecified role prey prey t18 fusion protein fusion protein c-term range C-terminal range c-term range c-term range C-terminal range c-term range false n/a 1343969 unspecified role unspecified role bait bait t25 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 7 envz-mzra-3 1343967 n/a 1343968 unspecified role unspecified role bait bait t18 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1343969 unspecified role unspecified role prey prey t25 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 7 mzra-mzra-3 1343967 n/a 1343969 unspecified role unspecified role prey prey t25 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1343969 unspecified role unspecified role bait bait t18 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false physical association physical association false false false Figure 7 envz-envz-2 1343967 n/a 1343968 unspecified role unspecified role prey prey t25 fusion protein fusion protein n-term range n-terminal range n-term range n-term range n-terminal range n-term range false n/a 1343968 unspecified role unspecified role bait bait t18 fusion protein fusion protein c-term range C-terminal range c-term range c-term range C-terminal range c-term range false physical association physical association false false false Figure 7