mpidb The Microbial Protein Interaction Database zielenkiewi-2009-1 In vivo interactions between toxin-antitoxin proteins epsilon and zeta of streptococcal plasmid pSM19035 in Saccharomyces cerevisiae. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Zielenkiewicz U., Kowalewska M., Kaczor C., Ceglowski P. ulazet@ibb.waw.pl J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation ztox_strpy Toxin zeta UDP-N-acetylglucosamine kinase protein protein strpy Streptococcus pyogenes MANIVNFTDKQFENRLNDNLEELIQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVIVIDNDTFKQQHPNFDELVKLYEKDVVKHVTPYSNRMTEAIISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKMYVMAVPKINSYLGTIERYETMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYSSLETPSISPKETLEKELNRKVSGKEIQPTLERIEQKMVLNKHQETPEFKAIQQKLESLQPPTPPIPKTPKLPGI eatx_strpy Antitoxin epsilon protein protein strpy Streptococcus pyogenes MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELNKNDSQLLEVNLLNQLKLAKRVNLFDYSLEELQAVHEYWRSMNRYSKQVLNKEKVA ztox-eatx 1335723 not-defined-491390883 1335724 unspecified role unspecified role bait bait not-defined-104542570 1335725 unspecified role unspecified role prey prey region Q57231-1-12 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false physical association physical association false false false table 3, 4 eatx-ztox 1335723 not-defined-104542570 1335725 unspecified role unspecified role bait bait not-defined-491390883 1335724 unspecified role unspecified role prey prey physical association physical association false false false table 3 ztox-eatx-1 1335723 not-defined-1733962541 1335725 unspecified role unspecified role prey prey region Q57231-1-66 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false region Q57231-1-29 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false not-defined-867017765 1335724 unspecified role unspecified role bait bait physical association physical association false false false table 3, 4