mpidb The Microbial Protein Interaction Database prysak-2009-1 Bacterial toxin YafQ is an endoribonuclease that associates with the ribosome and blocks translation elongation through sequence-specific and frame-dependent mRNA cleavage. in vitro In vitro emsa electrophoretic mobility shift assay Gel retardation assay band shift band shift Gel retardation assay emsa polyclonal western polyclonal antibody western blot polyclonal western Prysak M.H., Mozdzierz C.J., Cook A.M., Zhu L., Zhang Y., Inouye M., Woychik N.A. Mol. Microbiol. (0950-382X) 2009 Only protein-protein interactions imex curation yafq_ecoli mRNA interferase toxin YafQ yafQ b0225 JW0215 Endoribonuclease YafQ Toxin YafQ protein protein ecoli Escherichia coli (strain K12) MIQRDIEYSGQYSKDVKLAQKRHKDMNKLKYLMTLLINNTLPLPAVYKDHPLQGSWKGYRDAHVEPDWILIYKLTDKLLRFERTGTHAALFG dinj_ecoli_dna ds dna double stranded deoxyribonucleic acid ds DNA ds dna ecoli Escherichia coli (strain K12) dinj_ecoli Antitoxin DinJ dinJ JW0216 b0226 protein protein ecoli Escherichia coli (strain K12) MAANAFVRARIDEDLKNQAADVLAGMGLTISDLVRITLTKVAREKALPFDLREPNQLTIQSIKNSEAGIDVHKAKDADDLFDKLGI dinj-dinj 1335483 not-defined-1616626841 1335484 unspecified role unspecified role prey prey region his tag his tag Hexa-His-tag 6-His-tag Histidine-tag Hexa-His-tag Histidine-tag 6-His-tag undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false ecolx Escherichia coli n/a 1335485 unspecified role unspecified role bait bait region 32p radiolabel 32p radiolabel P32 32P 32P P32 undetermined undetermined sequence position undetermined undetermined undetermined sequence position undetermined false not-defined-56035444 1335486 unspecified role unspecified role prey prey ecolx Escherichia coli physical association physical association false false false Fig. 7