mpidb The Microbial Protein Interaction Database broms-2009-1 A conserved alpha-helix essential for a type VI secretion-like system of Francisella tularensis. yeasx Saccharomyces cerevisiae (Baker's yeast) Baker's yeast 2 hybrid two hybrid 2H 2h Gal4 transcription regeneration two-hybrid yeast two hybrid 2-hybrid classical two hybrid classical two hybrid 2H two-hybrid 2-hybrid Gal4 transcription regeneration 2h yeast two hybrid Y2H Y-2H 2 hybrid predetermined predetermined participant predetermined Bröms J.E., Lavander M., Sjöstedt A. jeanette.broms@climi.umu.se J. Bacteriol. (0021-9193) 2009 Only protein-protein interactions imex curation a4ivu0_fratw FTW_0038 FTW_0535 iglA1 iglA2 protein protein fratw Francisella tularensis subsp. tularensis (strain WY96-3418) MAKNKIPNSRLMINYETNVDGVLKKKELPYRVLVVGDLSKGRSVDAKKEFADREVRRVNNGVDRVLEEMNISFDFEAPNFVSKDRSNLKVNYRIESVKDFRPDAVAKKVPEIRALLEMKEILASFAKDIENNRNLKKTIDMIFSDSNELESLKSKIPALTNYTIKDSCDAAESQDLSNQQVDGK The sequence has been withdrawn from uniprot. a4ivu1_fratw FTW_0039 FTW_0536 iglB1 iglB2 protein protein fratw Francisella tularensis subsp. tularensis (strain WY96-3418) MTINKLSLTDELLNNFGGSTEVDSVLKNIDFDVSDDASKVLSLSTDYNARNLMALSLVLANNDNINNYNQKYIQKVITVIDKLIDLQVNSIISNDEFRALEQEWLKVQEVCQEDYDNVEVSILDVKKEELQYDFERNLYDISSSDFFKKVYVSEFDQYGGEPYGAILGLYNFENTTNDIIWLTGMGMVAKNSHAPFIASIDKSFFGVKDLSEITHIKSFEALLEHPRYKEWNDFRNLDVAAYIGLTVGDFMLRQPYNPENNPVQYKLMEGFNEFVDYDKNESYLWGPASIHLVKNMMRSYDKTRWFQYIRGVESGGYVKNLVACVYDNKGILETKSPLNVLFADYMELSLANIGLIPFVSEKGTSNACFFSVNSAKKVEEFVDGFDSANSRLIANLSYTMCISRISHYIKCVIRDKIGSIVDVESIQKILSDWISEFVTTVYQPTPLEMARYPFRNVSIEVKTIPGKPGWYSCKINVIPHIQFEGMNTTMTIDTRLEPELFGTNNN The sequence has been withdrawn from uniprot. iglb1-igla1 1335454 not-defined-894017398 1335455 unspecified role unspecified role prey prey val105ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false val109ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false leu116ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false ile112ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false leu115ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false leu122ala mutation decreasing strength mutation decreasing interaction strength mutation decreasing strength certain certain sequence position certain certain certain sequence position certain false leu115ala,phe125ala mutation disrupting strength mutation disrupting interaction strength mutation disrupting strength certain certain sequence position certain certain certain sequence position certain false certain certain sequence position certain certain certain sequence position certain false region A4IVU0-33-132 required to bind necessary binding region required to bind certain certain sequence position certain certain certain sequence position certain false not-defined-597714248 1335456 unspecified role unspecified role bait bait physical association physical association false false false